KEGG   Pseudomonas putida DLL-E4: DW66_5391Help
Entry
DW66_5391         CDS       T03439                                 

Definition
(GenBank) ribose-5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
ppud  Pseudomonas putida DLL-E4
Pathway
ppud00030  Pentose phosphate pathway
ppud01100  Metabolic pathways
ppud01110  Biosynthesis of secondary metabolites
ppud01120  Microbial metabolism in diverse environments
ppud01130  Biosynthesis of antibiotics
ppud01200  Carbon metabolism
ppud01230  Biosynthesis of amino acids
Module
ppud_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ppud_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ppud00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DW66_5391
Enzymes [BR:ppud01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     DW66_5391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind
Motif
Other DBs
NCBI-ProteinID: AHZ79888
UniProt: A0A059V607
LinkDB All DBs
Position
5943275..5943949
Genome map
AA seq 224 aa AA seqDB search
MTQDQLKQAVAQAAVDFILPKLDEKSVVGVGTGSTANFFIDALAQHKTAFDGAVASSEAT
AQRLKGHGIPVYELNSVSELEFYVDGADESDAHLNLIKGGGAALTREKIVAAVAKTFICI
ADASKLVPVLGAFPLPVEVIPMARSHVARQLVKLGGDPVYREGVVTDNGNVILDVHNLQI
TNPVELEAQINAIVGVVTNGLFAARPADLLLLGTSEGVKSLKAE
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggaccaactcaaacaggccgtcgcccaggccgctgtcgacttcattctgccc
aagctggatgaaaagagcgtcgtcggcgtcggcaccggttcgaccgccaacttcttcatc
gacgccctggctcagcacaagaccgccttcgacggcgcggtcgccagctccgaagccact
gcccagcgtctgaagggccatggcatcccggtctacgagctgaacagcgtcagcgaactg
gagttctacgtggacggcgccgacgagagcgacgcgcacctgaacctgatcaaaggcggc
ggcgcagccctgacccgcgagaagatcgtcgccgccgtggccaagaccttcatctgcatc
gccgatgccagcaagctggtaccggtgctgggcgcgttcccgctgccggtcgaagtgatc
ccgatggcccgcagccacgtggcgcgccagctggtcaaattgggcggtgacccggtgtac
cgtgagggcgtggttaccgacaacggcaacgtgatcctcgatgtgcacaacctgcagatc
accaacccggtggagctggaagcgcagatcaatgccattgttggcgtggtgaccaacggc
ctgttcgcggcacggccggcggatttgctgctgctgggtacctctgagggcgtgaaaagc
ctgaaggctgagtaa

DBGET integrated database retrieval system