KEGG   Pseudomonas putida HB3267: B479_05835Help
Entry
B479_05835        CDS       T02389                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh00620  Pyruvate metabolism
ppuh00680  Methane metabolism
ppuh01100  Metabolic pathways
ppuh01120  Microbial metabolism in diverse environments
ppuh01200  Carbon metabolism
Module
ppuh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B479_05835
  09102 Energy metabolism
   00680 Methane metabolism
    B479_05835
Enzymes [BR:ppuh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B479_05835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGA72083
UniProt: L0FGF3
LinkDB All DBs
Position
1311821..1314448
Genome map
AA seq 875 aa AA seqDB search
MTDIDVRLREDVHVLGELLGDTIRLQHGEAFLQKIEDIRHSAKADRRSAGEQLSSTLADL
ADEDLLPVARAFNQFLNLANMAEQYQLIRRRDADQPEPFEARVLPELLARLKQAGHSNDA
LARQLAKLDIQLVLTAHPTEVARRTLIQKYDAIAGQLAAQDHRDLTPGERQQVRERLRRL
IAEAWHTEEIRRTRPTPVDEAKWGFAVIEHSLWHAIPSHLRKVDKALLEATGLRLPLEAA
PIRFASWMGGDRDGNPNVTAAVTREVLLLARWMAADLFLRDIDALASELSMQQADDALRE
QVGDSPEPYRSLLKQLRDRLRATRAWAHSALTSSQPASAEVLVDNRDLIAPLELCYQSLH
ACGMGVIAEGPLLDCLRRAVTFGLFLGRLDVRQDAARHRDALSEITDYLGLGRYADWDEE
QRIEFLQAELKNRRPLLPAHFKPQAETAEVLATCREIAAAPAASLGSYVISMAGAASDVL
AVQLLLKEAGLTRPMRVVPLFETLADLDNAGPVMQRLLGLPGYRANLRGPQEVMIGYSDS
AKDAGTTAAAWAQYRAQENLVRICAEHQVELLLFHGRGGTVGRGGGPAHAAILSQPPGSV
AGRFRTTEQGEMIRFKFGLPGIAEQNLNLYLAAVLEATLLPPPPPQPAWREVMDQLAADG
VKAYRGVVRENPDFVEYFRQSTPEQELGRLPLGSRPAKRRAGGIESLRAIPWIFGWTQTR
LMLPAWLGWETALNNALARGQGELLAQMREQWPFFRTRIDMLEMVLAKADAQIAEAYDER
LVQPHLLPLGAHLRDLLSQSCQVVLGLTGQPVLLAHSPETLEFISLRNTYLDPLHRLQAE
LLARSRSREAALDSPLEQALLVTVAGIAAGLRNTG
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcgatgtgcgtttgcgtgaagatgtccatgtgttgggtgaactgcttggc
gataccattcgcctgcagcatggcgaggcgttcctgcagaagatcgaggacatccgtcac
agtgccaaggccgaccgccgtagcgccggcgagcaactgagctcgaccctagcggacctg
gccgatgaagacttgctgcccgtggccagggccttcaatcagttcctcaacctggccaac
atggccgagcagtaccagttgatccgccgccgcgacgccgaccagcccgagccgttcgag
gcccgggtgctgcccgagctgctggcgcgcctgaagcaggccgggcacagcaatgatgcc
ctggcccggcaattggccaagctcgacatccagctggtgctcactgcgcaccccaccgaa
gtggcccgccgcaccctgatccagaagtacgatgccatcgccggccaactggctgcccag
gaccaccgcgacctgaccccgggcgaacgccagcaggtgcgcgagcgcttgcgccggctg
atcgccgaggcctggcacaccgaagaaatccgccgcacccgaccgacgccggtggacgaa
gccaagtggggctttgcggtaatcgagcattcgctgtggcacgccatccccagccacttg
cgcaaggtcgacaaggccctgctggaggctaccggcctgcgcctgccgctggaagcggcg
ccgatccgcttcgcctcgtggatgggcggtgaccgtgatggcaaccccaacgtgaccgca
gcggtcacccgcgaagtcctgctgctggcgcgctggatggctgccgacctgttcctgcgc
gacatcgatgcgctggcttccgagttgtccatgcagcaggccgacgatgcgctgcgcgag
caggtcggcgacagtcccgaaccctaccgctccctgctcaagcaactgcgcgatcgcctg
cgagcaacgcgcgcgtgggcgcattcggcattgaccagcagccagccggccagcgccgag
gtgctggtggacaaccgcgacctgatcgcgccgctggagctgtgctaccagtccctgcac
gcctgcggcatgggtgtgatcgccgaaggcccgttgctcgactgcctgcgccgcgccgtg
acctttggcctgttcctgggccgcctggacgtgcgccaggacgccgctcgccaccgtgat
gcgttgagcgagattaccgactacctgggcttggggcgttatgccgactgggatgaagag
cagcgcattgagttcctacaggccgagctgaaaaaccgccggccactgctgcccgcgcat
ttcaagccgcaggccgaaaccgccgaggtgcttgccacctgccgggaaattgccgccgcg
ccagccgcatcgctgggctcttacgtgatctccatggccggtgccgcctcggatgtgctg
gcggtgcagctgctgttgaaggaggccggcctgacgcggcccatgcgcgtggtgccgctg
ttcgagaccctggccgacctcgacaatgctggcccggtgatgcaacgcctgcttggcctg
ccaggctaccgagcgaacctgcgcggcccgcaggaagtgatgatcggctattccgactcg
gccaaggacgctggtaccacggcagcagcctgggcgcagtaccgggcccaggaaaacctg
gtgcgcatctgcgccgagcaccaggtcgaattgctgctgttccacggccgtggcggcacg
gtgggccgcggcggtggcccggcccacgcggcgatcctgtcgcagccaccgggttcggtg
gcggggcgcttccgcaccaccgagcagggcgagatgatccgcttcaagttcggcttgccg
ggtatcgccgagcagaacctgaacctgtacctggctgcggtgctggaagccaccttgttg
ccaccgccaccaccgcagccggcctggcgcgaggtgatggaccagcttgccgccgatggc
gtcaaggcctaccgcggcgtggtgcgggagaaccccgattttgtcgagtacttccgccag
tcgaccccggagcaggaactggggcgcctgccgctgggcagccgaccggccaagcgccgc
gccggtggcatcgaaagcctgcgggccatcccgtggatcttcggctggacccagacccgc
ctgatgctgccagcctggcttggttgggaaacggcattgaacaatgccctggcccgtggc
cagggtgaactgctggcgcagatgcgcgagcaatggccgttcttccgcacccgcatcgac
atgctcgagatggtgctggccaaggccgatgcgcagatcgccgaggcctacgacgaacgt
ctagtgcaaccgcacctgctgcctttgggtgcgcacctgcgcgacctattgtcgcagtcg
tgccaggtggtactgggccttaccgggcagccggtgctactggcgcacagccccgagacg
ctggaattcatcagcctgcgcaatacctacctggacccgttgcaccgcctgcaggccgag
ttgctggcccgctcgcgcagccgcgaagccgctctggacagcccgttggagcaggccttg
ctggtgactgtggcgggtattgcagccggcctgcgcaacaccggctga

DBGET integrated database retrieval system