KEGG   Pseudomonas putida HB3267: B479_15250Help
Entry
B479_15250        CDS       T02389                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh00220  Arginine biosynthesis
ppuh01100  Metabolic pathways
ppuh01110  Biosynthesis of secondary metabolites
ppuh01130  Biosynthesis of antibiotics
ppuh01210  2-Oxocarboxylic acid metabolism
ppuh01230  Biosynthesis of amino acids
Module
ppuh_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    B479_15250
Enzymes [BR:ppuh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     B479_15250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AGA73944
UniProt: L0FJ09
LinkDB All DBs
Position
complement(3378495..3379655)
Genome map
AA seq 386 aa AA seqDB search
MSEFASRALLARLIGFATVSRDSNLELISFIRDYLAELGVESELFHNPEGTKANLFATIG
PRDVGGVVLSGHTDVVPVDGQAWTVEPFALSERDGRLYGRGTADMKGFIASVLAAVPAFL
AQPLRMPVHLAFSYDEEVGCLGVRSMLAALEQRPHKPRLCLIGEPTELKPVLGHKGKLAM
RCQVHGAACHSAYAPYGVNAIEYAAKLIGKLGDIGDALALPEHHDERFDPPFSTVQTGVI
KGGRALNIVPAECEFDFEVRALPGFEAQAVADQLQTYAEAELLPRMRKVNAASAIRLQPL
SAYPGLATPADSEAARLVALLSGSDEFGTVAFGTEGGLFDQAGIPTVVCGPGSMNQGHKP
DEFVSVEQLRGCDAMLLRLVDYLRQG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatttgccagtcgcgcgctgctggccaggctgatcggctttgccacggtcagc
cgggattccaatctcgaactgatcagcttcatccgcgactacctggccgagctgggggtg
gaaagcgaactgttccataacccggaaggtaccaaggccaacctgttcgccaccatcggc
ccccgggatgttggcggcgtggtgttgtccgggcataccgatgtggtgccggtggacggc
caggcctggacagtcgagccgtttgccctgagtgaacgcgacgggcgcctgtacggccgc
ggcacggccgacatgaagggtttcatcgcttcggtgctggcggctgtacccgcgtttctc
gcccagccgttgcgcatgccggtgcacttggcgttctcctacgacgaggaagtcggctgc
ctgggggtgcgctcgatgctggccgcgctcgagcagcgcccgcacaagccacggttgtgc
ctgattggcgaacccaccgaactcaagccggtgctggggcacaagggcaagctggcgatg
cgttgccaggtacatggcgcggcctgccactcggcgtacgcgccgtatggggtgaatgcc
atcgagtatgcggcgaagctgatcggcaagctgggtgatatcggtgatgccctggcgttg
ccggagcatcacgacgagcgcttcgacccaccgttctccactgtgcagaccggtgtgatc
aaagggggcagggcgctgaacatcgtgccggcggaatgcgaattcgatttcgaagtgcgg
gccttgcctgggttcgaggcgcaggcagtggccgaccagttgcaaacctatgccgaggcc
gaactgctgccgcgcatgcgcaaggtcaatgccgccagcgccattcgcctgcagccgttg
agtgcatatccggggctggccacgccagcggatagcgaggcggctcgcctggtggcgttg
ctcagtggttcggatgagttcggtaccgtggcgtttggtaccgaaggtgggctgttcgac
caggcgggcatcccgactgtggtgtgcgggcctgggagcatgaaccaggggcacaagccg
gatgagttcgtcagtgtcgagcagttgcgggggtgtgatgccatgttgctgaggttggtg
gattacctcaggcagggttga

DBGET integrated database retrieval system