KEGG   Pseudomonas putida HB3267: B479_17860Help
Entry
B479_17860        CDS       T02389                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh00020  Citrate cycle (TCA cycle)
ppuh00310  Lysine degradation
ppuh00380  Tryptophan metabolism
ppuh01100  Metabolic pathways
ppuh01110  Biosynthesis of secondary metabolites
ppuh01120  Microbial metabolism in diverse environments
ppuh01130  Biosynthesis of antibiotics
ppuh01200  Carbon metabolism
Module
ppuh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppuh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B479_17860
  09105 Amino acid metabolism
   00310 Lysine degradation
    B479_17860
   00380 Tryptophan metabolism
    B479_17860
Enzymes [BR:ppuh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     B479_17860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AGA74464
UniProt: L0FKH5
LinkDB All DBs
Position
complement(3927429..3928649)
Genome map
AA seq 406 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKQPGDAVKRDELIVDIETDKVVLEVLATADGVLGAIV
KGEGDTVLSDEVLGSIVEGGAAAAAPAAAPAAAAPAAAAADAGEEDPVAAPAARKLAEEN
GIDLAAVAGTGKGGRITKEDVVAAVANKKSAPAAAAKPAAAAAAAPVVVAAGDRTEKRVP
MTRLRAKIAERLVEAQSSMAMLTTFNEVDMTEVMALRSKYKDLFEKTHNGVRLGFMSFFV
KAATEALKRFPAVNASIDGNDIVYHGYADVGVAVSSDRGLVVPVLRNAESMSLAEIENGI
ATFGKKARDGKLAIEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPMAIN
GQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPSRLLLDI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccaaccttcccggaatcggttgccgatggcaccgttgcc
acctggcacaagcagccgggcgatgccgtcaagcgtgacgagctgatcgtcgacatcgag
accgacaaggtcgtcctggaagtactggccaccgccgacggcgtgctgggcgcaatcgtc
aagggcgagggcgacaccgtcctgtccgacgaagtactgggttcgatcgttgaaggcggt
gctgccgccgctgcaccagctgccgccccggccgctgctgccccggctgccgctgctgcc
gacgctggcgaagaagacccggttgccgccccggccgcgcgcaagctggctgaagagaac
ggcatcgacctggctgccgttgccggcaccggcaaaggtggtcgcatcaccaaggaagac
gtcgtcgctgccgtcgccaacaagaagtcggcgcctgctgcagctgccaagcctgccgcc
gctgccgctgctgccccggttgtcgttgccgctggcgaccgcaccgagaagcgcgtgcca
atgacccgcctgcgcgccaagatcgccgagcgtctggtcgaagcccagtcgagcatggcc
atgctgaccaccttcaacgaagtcgacatgaccgaagtcatggccctgcgttcgaagtac
aaggacctgttcgagaagacccacaacggcgtgcgcctgggcttcatgtcgttcttcgtc
aaggctgccaccgaagccctgaagcgcttcccggctgtcaacgcctcgatcgatggcaac
gacatcgtctaccacggctacgccgacgtcggcgttgccgtgtccagcgaccgtggcctg
gtggtaccggtactgcgtaacgccgagtcgatgagcctggcggaaatcgagaacggcatc
gccaccttcggcaagaaggctcgtgatggcaagctggccatcgaagagatgactggcggc
accttcaccatcaccaacggtggtaccttcggttcgatgatgtcgaccccgatcgtcaac
ccgccgcaggccgccattctcggcatgcacaacatcatccagcgcccgatggccatcaat
ggtcaggttgtgattcgcccgatgatgtacctggcgctgtcgtacgatcaccgcctgatc
gacggcaaggaagcggtaaccttcctggtcaccatcaagaacctgctggaagatccgtct
cgcctgctgctggacatctaa

DBGET integrated database retrieval system