KEGG   Pectobacterium punjabense: E2566_18855Help
Entry
E2566_18855       CDS       T06530                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ppuj  Pectobacterium punjabense
Brite
KEGG Orthology (KO) [BR:ppuj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E2566_18855 (ahpF)
Enzymes [BR:ppuj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     E2566_18855 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like Glutaredoxin FAD_binding_3 NAD_binding_8 DAO K_oxygenase Thi4 DSBA FMO-like Thioredoxin_4 AlaDh_PNT_C Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: QJA21821
LinkDB All DBs
Position
complement(4129736..4131298)
Genome map
AA seq 520 aa AA seqDB search
MLDNTMKVQLKAYLEKLTKPVELIATLDDSAKSAEVRTLLTDIAELSNQVSFIEKNDLSV
RKPSFLITNPGSQSGPRFAGAPMGHEFTSLILALLQVGGHPSKEAKELLDQIRNLDGAFH
FETYYSLSCHNCPDVVQALNLMAVLNPKITHTAIDGGVFQDEIQNRNVMGVPTVFLNGEH
FSQGRTSLAEIVTKIDTGAGAKQVEKLNQRDVYDVLIIGSGPAGAAAAVYSARKGIRTGL
VGERFGGQVLDTVDIENYISVPKTEGAKLATALKSHVDDYDVDVIDAQSAEALIPGGEPG
KPHQVITVSGATLKARSVIIATGARWRNMNVPGEDQYRTRGVTYCPHCDGPLFKGKHVAV
IGGGNSGVEAAIDLAGVVKHVTLLEFASELKADSVLQEKVRSLPNVDIILNAQTTEVKGD
GQKVTGLSYKDRLTDTVHDLALEGIFVQIGLLPNTHWLEGTVARNRIGEIEIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTRA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaatacgatgaaagtccagttgaaagcctatctggaaaaattaaccaaacct
gttgagttaattgcgactctggatgattccgctaaatctgcggaagtgagaaccttattg
accgatattgccgagttgtccaatcaggtcagctttattgaaaagaatgatctatccgtc
cgtaagccttcattcctgattaccaaccctggttcccaaagcggcccacgttttgccggt
gcgccgatgggacacgaatttacctccctgattctggcgttattgcaggtgggtggacat
ccgtcgaaagaagcaaaagaattactcgatcaaatccgcaatcttgacggtgcgttccac
tttgaaacgtattactcgctgtcctgccacaattgcccggacgtggtgcaggcgctgaat
ttaatggcggtgttgaatccgaagatcacccacaccgcgatagacggcggcgtgtttcag
gatgagatccaaaaccgtaatgtcatgggcgtccccactgttttcctgaacggagaacat
ttcagccaggggcgaacaagccttgctgagattgtgactaaaatcgatactggcgcgggc
gctaagcaggttgagaagctgaaccagcgtgacgtctatgatgtgttaatcatcggcagc
ggcccggcaggggcggcagcggcagtctattcggcgcgtaaaggcatccgcaccggtttg
gtcggtgagcgctttggcggccaggtgttggataccgttgatatcgaaaactacatttca
gtgccgaaaacggaaggtgccaaactggcaaccgcactgaagagccatgttgatgactat
gatgttgatgtgatcgacgcgcagagtgcagaagctttaattcctggtggagagccgggt
aaaccgcatcaggtgattaccgtatccggcgcgacgttgaaagcgcggagtgtgatcatt
gcgacgggcgcccgttggagaaacatgaatgtgcccggtgaagatcagtatcggacgcgt
ggtgtaacgtactgcccacactgtgatggcccactgtttaaaggcaagcacgttgcagtg
attggcggtggaaactcgggtgtagaagcggctatcgatctggctggtgtggtgaaacac
gtcacgctgcttgagttcgcatcggagctgaaagcggattctgtattgcaggagaaggta
cgcagcctgccaaacgttgacatcattctgaatgcgcaaaccacagaagtgaaaggcgat
ggccagaaggtgacggggctgagttacaaagatcgtcttactgatacggtgcatgattta
gcgctggaagggatctttgtacaaattggcctgctgcctaacacccactggctggaaggt
acggtagccagaaaccgcattggtgaaattgagatcgatgccaagtgtgaaaccagtgtg
aaaggggtctttgctgccggcgattgtacgacggtaccgtacaaacagattattatcgcg
acgggcgaaggcgcaaaagcatccttgagtgcttttgactacttgatcagaacccgtgca
taa

DBGET integrated database retrieval system