KEGG   Pandoraea pulmonicola: RO07_00330Help
Entry
RO07_00330        CDS       T03553                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ppul  Pandoraea pulmonicola
Pathway
ppul00020  Citrate cycle (TCA cycle)
ppul00480  Glutathione metabolism
ppul01100  Metabolic pathways
ppul01110  Biosynthesis of secondary metabolites
ppul01120  Microbial metabolism in diverse environments
ppul01130  Biosynthesis of antibiotics
ppul01200  Carbon metabolism
ppul01210  2-Oxocarboxylic acid metabolism
ppul01230  Biosynthesis of amino acids
Module
ppul_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppul_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ppul00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RO07_00330
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RO07_00330
Enzymes [BR:ppul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     RO07_00330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH TROVE
Motif
Other DBs
NCBI-ProteinID: AJC19327
UniProt: A0A0A8BRD9
LinkDB All DBs
Position
4030067..4032310
Genome map
AA seq 747 aa AA seqDB search
MSTQQPSIIYTLTDEAPLLATGSFLPIIRAFTAPAGVTVETSDISVAGRILGEFPEFLTE
EQRVPDNLAELGRLTQLPDTNIIKLPNISASVFQLQSAIKELQSKGYKVPDYPEDPKTDE
EKAIQKRYSKCLGSAVNPVLREGNSDRRAPLAVKNYAKKHPHSMGEWSMASRTHVAHMKH
GDFYHGEKSMTLDRARDVKMELVTKSGKTIVLKPKVSLLDGEIIDSMFMSKKALCAFYEE
QMEDARKTGVMFSLHVKATMMKVSHPIVFGHAVKIFYKEAFEKHGKLFDELGVNVNNGLV
NLYEKIESLPSSKREEIIRDLHACHEHRPELAMVDSAKGISNLHAPNDVIVDASMPAMIR
IGGKMWGADGRPKDTKAVIPESTFARIYQEIINFCKTNGAFDPTTMGTVPNVGLMAQKAE
EYGSHDKTFEIAEDGVANIVDIATGEVLLSQDVEAGDIWRMCQVKDAPIRDWVKLAVNRV
RNSGMPAVFWLDPYRPHEAELIKKVEKYLKDHDTTGLDIQIMSQVRAMRYTLERVIRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAVSLEDLGIKTGNARAKILAKTLDAATGKLLDNNKNPSPKTGELDNR
GSQFYLAMYWAQELAAQQDDADLAKAFAPLAKQLTENEKTIVGELADVQGKPADIGGYYK
PDFAKLEQVMRPSKTFNAALESVAKVA
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcagcaacccagcatcatctacaccctgaccgacgaagcaccgcttctggcc
accggctccttcctcccgatcattcgcgcgtttaccgccccggcgggcgtgacggtcgag
acgagcgacatctcggtggcaggccgtatcctcggcgaattccccgagttcctgaccgaa
gaacaacgcgtgccggataacctcgccgagctgggccgtctcacgcaactgccggacacg
aacatcatcaagctgccgaacatcagcgcatcggtgttccagctccagagcgccatcaag
gaattgcagtcgaagggctacaaggttccggactacccggaagatccgaagaccgacgaa
gagaaggccatccagaaacgctactcgaagtgcctcggctcggccgtgaacccggtgctg
cgcgaaggcaactcggatcgccgcgcgccgctggccgtcaagaactacgccaagaagcac
ccgcacagcatgggcgagtggagcatggcttcgcgcacgcacgtcgcgcacatgaagcat
ggcgacttctaccacggcgaaaagtcgatgacgctcgaccgcgcccgtgacgtgaagatg
gaactcgtcaccaagagcggcaagacgatcgtgctcaagccgaaggtctcgctgctcgac
ggcgaaatcatcgacagcatgttcatgagcaagaaggcgctctgcgcgttctacgaagag
cagatggaagacgcgcgcaagaccggcgtgatgttctcgctgcacgtgaaggccaccatg
atgaaggtctcgcacccgatcgtgttcggccacgccgtgaagatcttctacaaggaagcc
ttcgagaagcacggcaagctgttcgacgaactgggcgtgaacgtcaataacggtctcgtg
aacctgtacgagaagatcgaatcgctgccgagctcgaagcgtgaagagatcatccgcgat
ctgcacgcctgccacgagcaccgtccggaactggccatggtcgattcggccaagggtatc
tcgaacctgcacgcaccgaacgacgtgatcgtcgatgcatcgatgccggccatgatccgc
atcggcggcaagatgtggggcgccgacggccgtccgaaggacacgaaggccgtgatcccg
gagagcacgttcgcccgcatctatcaggaaatcatcaacttctgcaagacgaacggcgcg
ttcgatccgaccacgatgggtacggtgccgaacgtgggcctgatggcgcagaaggccgaa
gagtacggctcgcacgacaagacgttcgagatcgccgaagacggcgtggcgaacatcgtc
gacatcgccacgggcgaagtgctgctctcgcaggacgtggaagccggcgacatctggcgt
atgtgccaggtcaaggacgcgccgatccgcgactgggtgaagctcgccgtgaaccgcgtg
cgcaactcgggcatgccggccgtgttctggctcgacccgtaccgtccgcacgaagccgaa
ctgatcaagaaggtcgaaaagtacctcaaggaccatgacaccacgggcctcgacatccag
atcatgtcgcaggtgcgcgccatgcgttacacgctcgagcgcgtgatccgcggtctggac
accatctcggtgaccggcaacattctgcgcgactacctcaccgacctgttcccgatcatg
gaactgggcaccagcgccaagatgctgtcgatcgtgccgctgatggcgggtggcggcatg
tacgaaacgggtgctggcggctccgcgccgaagcacgtcaagcaactggtcgaagagaac
cacctgcgctgggactcgctgggtgaattcctggcgctggccgtgtcgctggaagacctt
ggcatcaagacgggcaacgcgcgcgccaagatcctcgccaagacgctcgacgctgccacg
ggcaagctgctcgacaacaacaagaacccgtcgccgaagaccggcgaactggacaaccgt
ggcagccagttctatctggcgatgtactgggcgcaggaactggccgcgcagcaggacgac
gccgacctggcgaaggccttcgccccgctggccaagcaactgaccgagaacgagaagacc
atcgtgggcgaactcgccgacgtgcaaggcaagccggccgacatcggcggctactacaag
ccggacttcgccaagctcgaacaggtcatgcgcccgagcaagacgttcaacgccgcgctg
gaaagcgtcgcgaaggtggcgtaa

DBGET integrated database retrieval system