KEGG   Pandoraea pulmonicola: RO07_05595Help
Entry
RO07_05595        CDS       T03553                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ppul  Pandoraea pulmonicola
Pathway
ppul00473  D-Alanine metabolism
ppul00550  Peptidoglycan biosynthesis
ppul01100  Metabolic pathways
ppul01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppul00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RO07_05595
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RO07_05595
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    RO07_05595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppul01011]
    RO07_05595
Enzymes [BR:ppul01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RO07_05595
Peptidoglycan biosynthesis and degradation proteins [BR:ppul01011]
 Precursor biosynthesis
  Amino acid ligase
   RO07_05595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATPgrasp_Ter ATPgrasp_ST ATP-grasp_4 CPSase_L_D2 TTL
Motif
Other DBs
NCBI-ProteinID: AJC20082
UniProt: A0A0A8BTJ8
LinkDB All DBs
Position
complement(5215940..5216878)
Genome map
AA seq 312 aa AA seqDB search
MGGRSAERQVSLISGNGVLEALRSRGVDAHAFDTGTQDLAALAAQKFDRVFIALHGRYGE
DGTLQGALEHLGIPYTGSGVLASALAMDKEMTKRVWINEGLPTPRFTMLSADSDFDTVAR
DLGLPLIVKPAREGSTIGLTKVTDASQLKAAYEKAAALDPDVLAEEFIDGDELTVPVLGV
GTKGAAAARSLPVIRIVAPDANYDYQNKYFKDDTRYECPPPLSVSLQEEVQRLVLRAYLV
LGCRGWGRVDVMLRKRDSKPFLLEINTSPGMTGHSLVPISARAAGLSYEDLVLEILATAT
LDLHPNAQWKPE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgggcgggcgctcggccgagcgtcaggtctcgctgatttcgggcaacggtgtgctcgaa
gcgctgcgctcgcgcggcgtggacgcccacgcgttcgataccggcacgcaggacctggcg
gcactcgccgcacagaagttcgaccgagtgttcatcgcgctgcacggccgttacggtgaa
gacggcacgctgcagggcgcgctcgagcatctgggcattccgtacaccggcagcggcgtg
ctggcttccgcgctggcgatggacaaggaaatgaccaagcgcgtctggatcaacgaaggg
ctgccgacgccgcgcttcacgatgctttcggctgacagcgatttcgatacggtcgcgcgc
gacctcggcctgccgctgatcgtcaagccggcgcgcgagggctcgaccatcggactgacg
aaggtcaccgatgcgtcgcaactgaaagccgcctacgagaaggccgccgcgctcgatccg
gacgtgctcgccgaggaattcatcgacggcgacgaactcaccgtgcccgtgctcggcgtg
ggcacgaagggggcggccgcggcgcgctcgctgccggtgatccgcatcgtggcgcctgac
gcgaactacgactaccagaacaagtatttcaaggacgacacccgctacgagtgcccgccg
ccgctatcggtgtcgttgcaggaagaagtgcagcgtctcgtgttgcgcgcgtatctcgtg
ctgggttgccggggctggggacgcgtcgacgtgatgctgcgcaagcgcgacagcaagccg
ttcctgctggagatcaatacgtcgccgggcatgaccggtcactcgctggtgccgatttcg
gcgcgcgcggcgggcctgtcgtacgaagacctggtgttggaaattctggccaccgcgacg
ctcgatctgcatccgaacgcgcagtggaagcccgagtaa

DBGET integrated database retrieval system