KEGG   Pandoraea pulmonicola: RO07_05720Help
Entry
RO07_05720        CDS       T03553                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppul  Pandoraea pulmonicola
Pathway
ppul00071  Fatty acid degradation
ppul00280  Valine, leucine and isoleucine degradation
ppul00281  Geraniol degradation
ppul00310  Lysine degradation
ppul00360  Phenylalanine metabolism
ppul00362  Benzoate degradation
ppul00380  Tryptophan metabolism
ppul00410  beta-Alanine metabolism
ppul00627  Aminobenzoate degradation
ppul00640  Propanoate metabolism
ppul00650  Butanoate metabolism
ppul00903  Limonene and pinene degradation
ppul00930  Caprolactam degradation
ppul01100  Metabolic pathways
ppul01110  Biosynthesis of secondary metabolites
ppul01120  Microbial metabolism in diverse environments
ppul01130  Biosynthesis of antibiotics
ppul01212  Fatty acid metabolism
Module
ppul_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    RO07_05720
   00650 Butanoate metabolism
    RO07_05720
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RO07_05720
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RO07_05720
   00310 Lysine degradation
    RO07_05720
   00360 Phenylalanine metabolism
    RO07_05720
   00380 Tryptophan metabolism
    RO07_05720
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RO07_05720
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RO07_05720
   00281 Geraniol degradation
    RO07_05720
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RO07_05720
   00627 Aminobenzoate degradation
    RO07_05720
   00930 Caprolactam degradation
    RO07_05720
Enzymes [BR:ppul01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RO07_05720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 DPPIV_rep
Motif
Other DBs
NCBI-ProteinID: AJC20097
UniProt: A0A378Z6X3
LinkDB All DBs
Position
complement(5245982..5246758)
Genome map
AA seq 258 aa AA seqDB search
MTYENILVETRGRVGLITLNRPKALNALNDALMDELGAALTAFDADEAIGCMVITGSEKA
FAAGADIGMMSKYTFADVFKGDYITRNWETVRRIRKPVIAAVSGFALGGGCELAMMCDFI
IAADNAKFGQPEIKLGVIPGAGGTQRLTRAVSKAKAMDMCLTARFMDASEAERAGLVSRV
VPLDTLLDEAIGAANTICEYSLPVVMAAKEAVNRAFESTLDEGVQFERRLFHSLFALEDQ
KEGMAAFVEKRKPVFKHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacgagaacattctggtggagacgcgcggccgcgtcggtctgatcacgctgaat
cgtccgaaagcactcaatgcgctgaacgatgccctcatggacgaactgggggcggcgctt
acggcgttcgacgccgacgaggccatcggctgcatggtgatcaccggcagcgagaaggcg
tttgccgcgggtgccgacatcggcatgatgtcgaagtacaccttcgccgacgtgttcaag
ggcgactacatcacgcgcaactgggagacggtgcgccgcatccgcaagccggtgatcgcg
gccgtgtcgggttttgcgctgggcggcggctgtgagctggcgatgatgtgcgatttcatc
atcgcggcggacaacgcgaagttcggccagccggaaatcaagctcggcgtgattccgggt
gcgggcggcacgcagcgtctgacgcgtgcggtgtcgaaggccaaggccatggacatgtgc
ctgacggcccgcttcatggatgcctccgaagccgagcgtgccggactggtgtcgcgcgtg
gtaccgctcgacacgctgctcgacgaagccatcggtgcagccaataccatctgcgaatac
tcgctgccggtcgtcatggcggccaaggaagcggtcaatcgcgccttcgaatcgacgctc
gacgagggcgtgcagttcgagcgtcgtctgttccattcgctgttcgcgctggaagatcag
aaggaaggcatggcggcgttcgtcgaaaagcgcaagccggtcttcaagcatcgctga

DBGET integrated database retrieval system