KEGG   Pandoraea pulmonicola: RO07_15370Help
Entry
RO07_15370        CDS       T03553                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ppul  Pandoraea pulmonicola
Pathway
ppul00620  Pyruvate metabolism
ppul00680  Methane metabolism
ppul01100  Metabolic pathways
ppul01120  Microbial metabolism in diverse environments
ppul01200  Carbon metabolism
Module
ppul_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ppul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RO07_15370
  09102 Energy metabolism
   00680 Methane metabolism
    RO07_15370
Enzymes [BR:ppul01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     RO07_15370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AJC21524
LinkDB All DBs
Position
complement(1545285..1548323)
Genome map
AA seq 1012 aa AA seqDB search
MKSSAKAKAPQEGLATSVGNTPPAKAAAAAPSTPGAAQAASTASPTSRASGASRTSPTST
GSATTDAQTPSKIPSKSRRSREDKDAPLREDIRFLGRLLGDVLREQQGSDAFDLVETIRQ
NAVRFHREGDRSAAKALDTLLNGLTNEQAIQVVRAFSYFSHLANIAEDRHHNRRRRVHAL
AGSRPQPGSLSAALQSLKDAGRADPATLQAFFASALIVPVLTAHPTEVQRKSILDAEREI
ARLLEHRDDALTERESARNTESMRAYVTTLWQTRMLRSSRLTVADEIENALSYYRSTFLS
EIPALYDDVAAELHDAVPSVRSEGLGRFLQMGSWIGGDRDGNPNVTAQTLQLAITRQATE
IFAHYLEQVHLLGAELSVSQLLAGASDALLTLARRSPDDSPHRTDEPYRRALIGVYARLA
ATARAWVGHVPHRGAVGEASPYLDASEFISDLNTVVTSLIAHHGSALIPQRLGPLVRAAE
VFGFHLASIDLRQSSDVHEAVIAELFAKAGVEANYAKLDEDAKLALLLRELREPRPLFSP
YLEYSQRTRDELAVFAAARDIRARFGTRAVRNYIISHTETVSDLVEVMLLQKETGLFQGA
LGGKGSKTVEPKVGAMVIPLFETIADLRNAPVIMREFFDIPGMSEVAVQQGGEQEVMLGY
SDSNKDGGFLTSNWELYKAELALVRLFEEKGIRLRLFHGRGGTVGRGGGPTYQAILSQPP
GTVNGQIRLTEQGEIIASKFANPEIGRRNLETIVAATLEATLLPSRNQPTRLAAFETVMQ
TLSDTAFTAYRDLVYETPGFTDYFFSATPIAEIAELNIGSRPASRKFSDPKNRRIEDLRA
IPWGFSWGQCRLLLTGWYGFGSAVNAYLEGEGDAGREKRLDTLRQMVKRWPFFANLLSNM
DMVLAKTDLAVASRYAELVPDEKLRKRVFDRIVAEWQSTSQALALITGHEERLADNPMLA
RSIKNRFPYLDPLNHLQVELLRRHRAGESDERARRGIHLSINGIAAGLRNTG
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcagcgcaaaggcaaaagccccgcaagagggcctcgccacgtcggtcggcaac
actccccccgcgaaggcagcagccgcggccccatccactcccggtgcggcgcaggccgcc
tcgaccgcgtcgccgacatctcgagcatccggggcttcacgtacatcccccacgtccacc
ggatcggccaccaccgacgcccagactccgtcgaagatcccgtcgaagtcccgccgttcg
cgcgaagacaaggacgccccgctgcgcgaggacatccgcttcctcggccgcctgctcggc
gacgtactgcgtgagcagcaaggcagcgacgccttcgatctggtcgaaaccatccgccag
aacgccgtgcgctttcaccgcgaaggcgatcgcagcgccgcaaaggcgctcgacacgctg
ctcaatggcctgacgaacgagcaggcgattcaggtggtgcgcgcattcagctacttctcg
catctggccaacatcgccgaggaccggcatcacaaccgccgccgccgcgtgcatgcgctc
gccggcagccgcccgcagcccggcagcctgagcgccgcgctgcaaagcctcaaggacgcc
gggcgcgccgaccccgccacgctgcaggccttcttcgccagcgcgctgatcgtgccggtg
ctcaccgcgcacccgaccgaagtccagcgcaagagcattctcgacgccgagcgcgagatc
gcccgtctgctggagcatcgcgacgacgccctcaccgagcgcgaatccgcgcgcaacacg
gaatcgatgcgcgcctacgtcaccacgctctggcaaacgcgcatgctgcgcagttcgcgc
ctaaccgtggccgacgagatcgagaacgcgctctcgtactaccgcagcaccttcctgtcc
gaaattcccgcgctgtacgacgacgtagccgccgagctgcacgacgccgtgcccagcgtg
cgctccgaaggcctcggccgcttcctgcaaatgggcagctggatcggcggcgaccgcgac
ggcaacccgaacgtcacggcgcagacgctgcaactggcgatcacgcgtcaggccacggaa
atcttcgcgcattacctggagcaggtgcacctgctcggcgcggaactgtccgtctcgcaa
ctgctcgccggcgccagcgacgcgctgctcacgctcgccagacgctctcccgacgactcc
ccgcaccgcaccgacgagccgtaccggcgcgcgctgatcggcgtgtacgcacggctggcc
gccaccgcacgcgcgtgggtcggtcacgtgccgcatcgcggcgcggtcggcgaggccagc
ccgtatctcgacgccagcgaattcatctcggatctgaacaccgtcgtcacgtcgctcatc
gcccaccatggcagcgcgctgatcccgcagcgcctcgggccgctcgtgcgcgccgccgaa
gtattcggcttccatctcgcgagcatcgacctgcgccagagctcggacgttcatgaggcg
gtcatcgccgagctgttcgccaaggccggcgtggaagcgaactacgcgaagctcgacgag
gacgccaagctcgcgctgctgttgcgggaattgcgcgagccgcgtccgctcttctcgccg
tatctcgagtattcgcagcgcacgcgcgacgagttggcggtcttcgccgccgcccgcgac
atccgggcccggttcggtacgcgcgccgtgcgcaactacatcatttcgcacacggaaacc
gtgagcgacctggtggaagtcatgctgctgcaaaaggagaccggcctgtttcagggagcg
ctgggcggcaagggctcgaagaccgtcgagccgaaagtcggtgccatggtcatcccgctg
ttcgagacgatcgccgacttgcgcaacgcgccggtcatcatgcgcgagttcttcgacatc
cccggcatgtccgaggtggcggtgcagcaaggcggcgagcaggaagtcatgctcggctac
tccgacagcaacaaggacggcggcttcctcacgtcgaactgggagctctacaaggccgaa
ctcgcactcgtgcgcctgttcgaggagaaaggcatccgtctgcgcctgttccatggccgg
ggcggcaccgtgggtcgcggcggcggcccgacctatcaggccatcctgtcccagccgccg
ggcacggtgaacgggcagatccgactgaccgagcagggcgaaatcatcgccagcaagttc
gccaacccggagatcgggcgacgcaacctggagaccatcgtcgccgccacgctcgaagcc
acgctgctgcccagccgcaaccagccgacacgtctggccgcgttcgagaccgtcatgcag
acgctttccgacacggccttcaccgcctatcgcgatctggtctacgagacaccgggcttc
accgactacttcttctcggccacgccgattgcggaaatcgccgagctcaacatcggctcg
cgtcccgcgtcgcgcaagttctccgatccgaagaaccgccgcatcgaagacctgcgcgcg
attccgtggggcttctcgtggggccagtgccgcctgctgctcacgggctggtacggcttc
ggcagcgcggtgaacgcgtatctcgagggtgagggcgacgccggccgcgagaagcgcctc
gacacgctgcgtcagatggtcaagcgctggccgttcttcgcgaacctgctctcgaacatg
gacatggtgctcgccaagaccgatctggccgtggcgtcgcgctatgccgaactcgtgccg
gacgagaagctgcgcaagcgcgtgttcgaccgcatcgtggccgaatggcagagcacgtcg
caggcgctcgcgctgatcaccggtcacgaggaacggctggccgacaacccgatgctcgcg
cgctcgatcaagaaccgcttcccgtacctcgatccgctcaaccacttgcaggtcgaactg
ctgcgccgtcaccgggcgggcgagtcggacgaacgcgcgcggcgcggcatccatctgtcc
atcaacggcattgccgccggcctgcgcaatacaggctga

DBGET integrated database retrieval system