KEGG   Pandoraea pulmonicola: RO07_18100Help
Entry
RO07_18100        CDS       T03553                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ppul  Pandoraea pulmonicola
Pathway
ppul00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ppul00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RO07_18100
Enzymes [BR:ppul01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RO07_18100
Transporters [BR:ppul02000]
 Other Transporters
  Pores ion channels [TC:1]
   RO07_18100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_N_4 Tom37 GST_C
Motif
Other DBs
NCBI-ProteinID: AJC21920
UniProt: A0A0A8BW65
LinkDB All DBs
Position
2216760..2217413
Genome map
AA seq 217 aa AA seqDB search
MLKLYGFPISNYYNKVKVVLYEKGLPFEEVESIPCQDEPVLQCSPLGKVPYLQTEHGYLA
ESQVICDYLEAAHPTPALFSQDPWRQAKERELLTMLELHLELVVREVYTQAFFGGTVSEG
TRSRTEKLLRRNIVAFKRLAKFSPYLAGETFTMADVAAGIHLPILGMATQAVYGEDFLQS
ASIDWKAYGKQLAERESFQRMRAEQKAYQQAQKAKAG
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagctgtacggatttccaatcagcaactactacaacaaggtcaaggttgtgctg
tacgagaagggtctgcccttcgaagaagtcgagtcgatcccgtgccaggacgagccggtg
ctgcagtgctcgccgctcggcaaggtgccgtatctgcagaccgaacacggctatctggcc
gagtcgcaggtaatctgcgattacctcgaagccgcgcatccgacgccggcgctgttctcg
caggacccgtggcgccaggcaaaggagcgcgaattgctcacgatgctcgaactgcatctg
gagctggtcgtgcgcgaagtgtacacgcaggcgttcttcggcggcacagtgtcggaaggc
acgcgcagtcgcaccgagaagctgctgcgccggaacatcgtggcgttcaagcgtctggcg
aagttctcgccgtacctggcaggcgagacgttcaccatggccgacgttgccgccggtatc
catctgccgattctcggcatggccacgcaggcggtgtacggcgaggatttcctgcagagc
gccagcatcgactggaaagcgtatggcaagcagttagcggagcgcgagtcgttccagcgc
atgcgtgccgagcagaaggcgtatcagcaggcgcagaaggccaaggcgggttga

DBGET integrated database retrieval system