KEGG   Pandoraea pulmonicola: RO07_20170Help
Entry
RO07_20170        CDS       T03553                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
ppul  Pandoraea pulmonicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Semialdhyde_dh OmdA
Motif
Other DBs
NCBI-ProteinID: AJC22230
LinkDB All DBs
Position
2674809..2676242
Genome map
AA seq 477 aa AA seqDB search
MITYDKFYIDGKWVSPVGKGELEVFHSADATLMGRIPEGAVEDAEAAIAAARKARDGWAA
TAPAERAGYLRRIAAGLKARTDELAQAMTGETGMPIKLVRAIQVGGPVYHWNKYAELAES
FEFEARVGNSLVVREPVGVVGAITPWNYPLNQITLKVAPALAAGCTVVLKPSEVAPFNAF
ILAEVIAEAGLPAGVFNLVTGLGPVVGEVLARHPDVDMVSFTGSTRAGKRVSEVASQTVK
RVALELGGKSASVVLDDADLAAAVKGTLNACYLNSGQTCSAHTRMLVPASRYEEVKALAK
EAVARFTLGDPREETTRLGPLASAAQRERVRNYIRKGLAEGAELIAGGDAVPEGFETGFF
VQPTVLGRVTPDATVAQEEIFGPVLSIITYQDEADAVRIANDSIYGLGGGVWSGDEARAV
RVARQIRTGQVDINGGEFNVQAPFGGFKQSGHGRENGVYGFEEFLEYKSLQFRVAKS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgtacgacaagttctatatcgacggcaagtgggtcagcccggtggggaaaggc
gagctcgaggtgttccactcggctgatgcaacgctcatggggcggattcccgaaggagcc
gtggaggacgccgaggcggccatcgcggcagcgcgcaaggcgcgcgatggctgggcggca
acggcgcccgccgaacgcgccggttatctgcgcaggattgccgcgggactgaaagcgcgt
accgacgaactggcgcaggcgatgaccggtgagacgggcatgccgatcaagctcgtgcgc
gccatccaggtcggcggcccagtctatcactggaacaagtacgccgaactggccgagtcg
ttcgagttcgaggcgcgcgtgggcaattcgctcgtcgtgcgcgagccggtgggtgtcgtc
ggcgcgatcacgccgtggaactacccgctcaatcagatcacgttgaaggtcgctcccgca
ctggctgccggatgtacggtggtgctcaagccatccgaagtggcgccgttcaatgcgttc
atcctcgccgaagtgatcgccgaggccgggttgccggcgggcgtcttcaatctggtgacg
ggactggggccggtcgtgggcgaagtcctcgcgcgacacccggacgtcgatatggtgtcg
ttcaccggttcgacgcgcgcgggcaagcgtgtctccgaagtggcgtcgcagaccgtcaag
cgcgtggcgctcgaactgggcggcaagtcggcgtccgtggtgctcgatgacgccgatctg
gcggccgccgtcaaaggcacgctcaacgcgtgctatctgaactccggacaaacctgctcg
gcgcacacgcgcatgctcgtgccggcgtcgcgctacgaggaagtcaaggcgttggcgaag
gaggccgtcgcgcgtttcacgttgggcgatccacgcgaggagacgacgcgtctggggccg
ttggcgtcggctgcccagcgcgagcgtgtgcggaactacatccgcaagggactggccgaa
ggcgccgaactgatcgcaggcggcgacgccgtgcccgagggcttcgagacgggattcttc
gtgcagccgacggtgctcggacgtgtgacgccggatgcgacggtggcgcaggaagagatc
ttcggccccgtgctctcgatcattacctatcaggacgaagccgacgccgtgcgcatcgcc
aacgactccatctatggtctgggcggcggcgtgtggtcgggcgacgaggcacgggctgtg
cgcgtcgcgcgtcagatccgcacggggcaggtggacatcaacggtggtgagttcaacgtg
caggccccgtttggtggtttcaagcagtcagggcacggacgggaaaacggcgtctatggg
ttcgaggagtttctcgaatacaagtcgctgcagttcagggttgcgaagtcgtag

DBGET integrated database retrieval system