KEGG   Pandoraea pulmonicola: RO07_21660Help
Entry
RO07_21660        CDS       T03553                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
ppul  Pandoraea pulmonicola
Brite
KEGG Orthology (KO) [BR:ppul00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ppul02022]
    RO07_21660
Two-component system [BR:ppul02022]
 OmpR family
  Unclassified
   RO07_21660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AJC22435
UniProt: A0A378ZCY5
LinkDB All DBs
Position
complement(3086782..3087522)
Genome map
AA seq 246 aa AA seqDB search
MEKIDHVLIVDDDRGIRELLANYLEKNGMRVSVAANGREMRSVLADGAPDLIVLDLMLPG
GDGLVLCRELRAGKFRAVPVLMLTARGEETDRIVGLEMGADDYLAKPFAVRELLARIKSV
LRRTRMLPPGMQITETAEILAFGEWQLDTTARHLLDGEGTQVALSGAEYRLLRVLLDHPQ
RVLTRDQLLNLTQGRQADAFDRSIDLLVSRLRQRLGDGAREPRYIKTLRNEGYVFCAAVT
VVAAPQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatcgatcatgtgctgatcgtcgacgacgatcgcggcattcgggaactgctc
gccaactatctcgagaagaacggcatgcgcgtgagcgtggccgcgaacggccgcgagatg
cgatcggtactggccgacggcgcgcccgacctcatcgtgctcgacctgatgctgcccggc
ggcgacggcctggtgctgtgccgcgagttgcgcgcgggcaagttccgcgcggtgccggtg
ctcatgctgaccgcgcgcggcgaggagaccgatcgtatcgtcggcctggagatgggggcg
gacgattacctcgccaagccgttcgcggtgcgtgagttgctcgcccgcatcaagtccgtg
ctgcgccgcacgcgcatgctgccgccgggcatgcagatcaccgaaaccgccgagattctg
gcgttcggcgaatggcagctcgataccacggcgcggcatctacttgatggcgagggaacg
caggtggcgctgagcggcgccgaataccggctgctgcgcgtgctgctcgatcatccgcaa
cgcgtgctcacgcgcgatcagttgctcaacctcacgcaaggccgccaggccgacgccttt
gatcgctcgatcgatctgctcgtgagccgcctgcgtcaacggttgggcgacggcgcgcgc
gagccgcgctacatcaagacgctgcgcaacgagggctatgtcttctgcgcggcggtcacc
gtggtggcggcgccgcaatga

DBGET integrated database retrieval system