KEGG   Pseudomonas putida NBRC 14164: PP4_08880Help
Entry
PP4_08880         CDS       T02707                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ppun  Pseudomonas putida NBRC 14164
Brite
Enzymes [BR:ppun01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PP4_08880 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAN52741
LinkDB All DBs
Structure
PDB: 

Position
complement(1027197..1027793)
Genome map
AA seq 198 aa AA seqDB search
MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS
SGGIFNNAAQVWNHTFYWNCLSPNGGGQPTGALAEAINAAFGSFDKFKEEFTKTSVGTFG
SGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWAFVAEQFEGKTFKA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattgccgccgctgccgtacgcccacgatgccctgcagccgcacatctcc
aaggaaaccctggagtatcaccacgacaagcaccacaacacctatgtcgtgaacctgaac
aacctggtcccaggcaccgaattcgaaggcaagaccctggaagagatcgtcaagagctct
tcgggcggcatcttcaacaacgccgctcaggtctggaaccacaccttctactggaactgc
ctgtcgccaaacggcggcggccagcctaccggtgccctggctgaagccatcaacgccgct
ttcggttccttcgacaagttcaaggaagagttcaccaagacttcggttggcaccttcggt
tccggctggggctggctggtgaagaaagctgacggttccctggccctggccagcaccatc
ggcgccggttgcccgctgaccagcggcgacaccccgctgctgacctgcgacgtctgggaa
cacgcctactacatcgactaccgcaacctgcgtccgaagtacgtcgaggcgttctggaac
ctggtcaactgggccttcgttgccgagcagttcgaaggcaagaccttcaaggcctga

DBGET integrated database retrieval system