KEGG   Pseudomonas putida NBRC 14164: PP4_18640Help
Entry
PP4_18640         CDS       T02707                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ppun  Pseudomonas putida NBRC 14164
Brite
KEGG Orthology (KO) [BR:ppun00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PP4_18640 (ahpF)
Enzymes [BR:ppun01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PP4_18640 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like AlaDh_PNT_C DAO FAD_oxidored NAD_binding_7 FAD_binding_3 Glutaredoxin FMO-like Thi4 K_oxygenase NAD_binding_8 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: BAN53717
LinkDB All DBs
Position
2131407..2132969
Genome map
AA seq 520 aa AA seqDB search
MLDATLKSQLKTYLERVTQPIEIVASLDDGAKSRELHDLLVEIAGLSNLITFSADGTDAR
RPSFSLNRPGSDISLRFAGIPMGHEFTSLVLALLQVGGHPSKASAEVIEQIQALEGEFTF
ETYFSLSCQNCPDVVQALNLMAVLNPNVRHVAIDGALFQDEVESRKIMAVPSVYLNGEVF
GQGRMGLEEILGKIDTSAGARQAEKINAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTLAIENFISVQETEGPKLATALEEHVKQYDVDIMNLQRGEALIPATDGGL
HEVRLAGGASLKAKTVILATGARWREMNVPGEQEYRGRGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAQVTLIEFDSQLRADAVLQRKLHSLPNVKVITSALTTEVLGNGE
KVTGLRYKDRTTDETHDVALEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDAKGQTSIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLAAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccacgcttaaatcgcaactgaaaacctacctggagcgggtcacccagccg
atcgagatcgtagcctccctcgacgacggcgcgaagtcccgcgaattgcacgacctgctg
gtggaaattgccggtttgtcgaacctcattaccttcagcgcggacggtaccgatgcccgt
cgcccgtcgttctcgctgaaccgcccgggtagcgatatcagcctgcgcttcgccggcata
cccatgggccacgaattcacttcgctggtgctggcgctgctgcaagtcggcggccacccg
tccaaggccagtgccgaagtgatcgagcagatccaggcgctggaaggcgagttcaccttc
gaaacctacttctcgctgtcgtgccagaactgcccggacgtggtccaggcgctgaacctg
atggcagtgctcaaccctaatgtgcgccatgtggccatcgacggtgcgctgttccaggac
gaagtggaatcgcgcaagatcatggcggtgccaagcgtctacctgaacggcgaagtgttc
ggccagggccgcatgggcctggaagaaatcctcggcaagatcgacaccagtgccggtgct
cgccaggccgagaagatcaacgccaaggacgctttcgatgtactggtggtcggtggtggc
ccggccggcgcggcagcggccatctacgccgcacgtaaaggcatccgcaccggtgttgct
gccgagcgcttcggcggccaggtgctcgataccctggccatcgaaaacttcatctcggtg
caggaaaccgaagggccgaaactggccacggcactggaagaacacgtcaagcaatacgac
gtggacatcatgaacctgcagcgcggcgaagcgctgattccggccaccgatggcggcctg
catgaagtacgcctggccggcggtgcctcgctcaaggccaagaccgtgatcctggccacc
ggcgcccgctggcgcgaaatgaacgtgccgggcgagcaggaataccgcggccgtggcgtg
gcttactgcccgcactgtgacggcccgctgttcaaaggcaagcgcgtggcggtgatcggc
ggcggcaactcgggcgtggaagcggccatcgacctggccggcatcgtcgcccaggtgacg
ctgatcgaattcgacagccagctgcgtgccgatgcagtgttgcaacgcaagctgcacagc
ctgccgaacgtgaaagtgatcaccagcgcgctgaccaccgaagtgctgggcaatggtgag
aaagtgaccggcctgcgctacaaggatcgcactacggatgaaacgcacgacgtggcgctg
gaaggcatcttcgtacagatcggcctgctgccgaacactgattggctgaagggcaccgtc
gagctgtcgccgcgtggcgagatcatcgtcgatgccaagggccagaccagcatcccgggc
gtgtttgccgccggtgacgtgactaccgtgccgtacaagcagatcgtgattgctgtgggt
gaaggggccaaggcttcgctggcagccttcgatcacctgatccgtacttcggctccggca
taa

DBGET integrated database retrieval system