KEGG   Pseudomonas putida NBRC 14164: PP4_21000Help
Entry
PP4_21000         CDS       T02707                                 

Gene name
alr
Definition
(GenBank) putative alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
ppun00473  D-Alanine metabolism
ppun01100  Metabolic pathways
ppun01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppun00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PP4_21000 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    PP4_21000 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppun01011]
    PP4_21000 (alr)
Enzymes [BR:ppun01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     PP4_21000 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:ppun01011]
 Precursor biosynthesis
  Racemase
   PP4_21000 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: BAN53953
LinkDB All DBs
Structure
PDB: 

Position
2385799..2387028
Genome map
AA seq 409 aa AA seqDB search
MPFRRTLLAASLALLITGQAPLYAAPPLSMDNGTNALTVQNSNAWVEVSASALQHNIRTL
QAELAGKSKLCAVLKADAYGHGIGLVMPSIIAQGVPCVAVASNEEARVVRASGFTGQLVR
VRLASLSELEDALQYDMEELVGSAEFARQVDAVAARHGKTLRIHMALNSSGMSRNGVEMA
TWSGRGEALQITDQKHLKLVALMTHFAVEDKDDVRKGLAAFNEQTDWLIKHAKLDRSTLT
LHAANSFATLEVPEARLDMVRTGGALFGDTVPARTEYQRAMQFKSHVAAVHSYPAGNTVG
YDRTFTLARDSRLANITVGYSDGYRRVFTNKGHVLINGHRIPVVGKVSMNTLMVDVTDFP
DVKGGNEVVLFGKQAGGEITQAEMEEINGALLADLYTVWGSSNPKILVD
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccatttcgccgtacacttctggccgcatccctggccctgctgatcaccggccaagcc
ccactgtatgccgcccccccgctgtcgatggacaacggtacaaacgccctgaccgtgcaa
aacagcaacgcctgggtcgaagtcagcgccagcgctctgcagcacaacatccgcaccctg
caggccgagctggccggcaagtccaagctgtgcgccgtgctcaaggccgatgcctatggc
cacggtatcggcctggtaatgccatcgatcatcgcccagggcgtgccctgcgtggcggtg
gccagcaacgaggaggcccgcgtggtccgcgccagtggcttcaccgggcaactggtgcgg
gtacgcctggccagcctcagcgagctggaagatgccttgcagtacgacatggaagagctg
gtgggcagcgccgaatttgcccgccaggtcgatgccgtcgccgcgcgccatggcaagacc
ttgcgcattcacatggcgctcaactccagcggcatgagccgcaacggggtggagatggcc
acctggtccggccgtggcgaagcgctgcagatcaccgaccagaagcacctcaaactggtc
gcgctgatgacccacttcgccgtggaagacaaggacgatgtgcgcaagggcctggcggcc
ttcaacgagcagaccgactggttgatcaagcacgcgaagctcgaccgcagcacgctcacc
ctgcacgccgccaactcgttcgctacgctggaggtgccggaggcgcgcctggacatggta
cgcaccggtggcgcgctgttcggtgacaccgtaccggcgcgcaccgagtaccaacgcgcc
atgcagttcaagtcgcacgtggcggcggtgcacagttacccggccggcaacaccgtcggc
tacgaccgcaccttcaccctggcccgtgattcgcgcctggccaacatcaccgtcggctat
tccgatggctatcgccgggtgttcaccaacaagggccatgtgctgatcaacggccaccgc
ataccggtggtgggcaaggtgtcgatgaacacgctgatggtcgatgtcaccgacttcccg
gacgtgaagggtggcaacgaagtggtgctgttcggcaagcaggccgggggcgaaatcacc
caggccgagatggaagaaatcaacggcgcgctgctggccgacctgtacaccgtgtggggc
agttccaacccgaagatcctcgtcgactga

DBGET integrated database retrieval system