KEGG   Pseudomonas putida NBRC 14164: PP4_23380
Entry
PP4_23380         CDS       T02707                                 

Definition
(GenBank) peptidase U32 family protein
  KO
K08303  putative protease [EC:3.4.-.-]
Organism
ppun  Pseudomonas putida NBRC 14164
Brite
KEGG Orthology (KO) [BR:ppun00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ppun01002]
    PP4_23380
Enzymes [BR:ppun01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     PP4_23380
Peptidases and inhibitors [BR:ppun01002]
 Peptidases of unknown catalytic type
  Family U32
   PP4_23380
SSDB
Motif
Pfam: Peptidase_U32 DUF3656
Other DBs
NCBI-ProteinID: BAN54191
LinkDB
Position
complement(2663484..2665484)
AA seq 666 aa
MSLPKNHLELLSPARDVAIAREAILHGADAIYIGGPSFGARHNACNEVGEIAELVEFARR
YHARVFTTINTILHDNELEPARKLIHQLYDAGVDALIVQDLGVMELDIPPIELHASTQTD
IRTLERAKFLDQAGFSQLVLARELNLQQIRAIAAETDAAIEFFIHGALCVAFSGQCNISH
AQTGRSANRGDCSQACRLPYTLKDDQGRVVAFEKHLLSMKDNNQTANLADLVDAGVRSFK
IEGRYKDMGYVKNITAHYRKELDAILEGRPEYARASSGRTEHFFLPDPDKTFHRGSTDYF
VTDRKVDIGAFDSPTFTGLPVGVVEKVGKRDMQVVTEVPLTNGDGLNVLVKREVVGFRAN
IAEPRGEFEEDGQKRYRYRVEPNEMPEGLHKLRPNHPLSRNLDHNWQQALQRTSSERRVG
VEWHAVLREQRLMLTLSSEEGVSVQVALDGPFGEANKPQQALDQLHDLLGQLGTTMYHAS
SIELDAPQAYFIPNSQLKALRREAIEALTEARIKAHPRGGRKAETTPPPVYPESHLSFLA
NVYNQKARDFYHRHGVQLIDAAYEAHEEHGEVPVMITKHCLRFSFNLCPKQAKGVTGVRT
KVAPMQLIQGDEVLTLKFDCKPCEMHVVGKMKSHIIDLPTPGSAVAQVVGHISPEDLLKT
IVRAPH
NT seq 2001 nt   +upstreamnt  +downstreamnt
atgtcccttccaaagaatcacctggaactgctcagccctgcccgtgacgtggccatcgcc
cgtgaagcgatcctgcacggcgctgacgccatctacatcggcggcccaagctttggcgca
cgccataacgcctgcaacgaagtgggcgagatcgccgaactggtcgagttcgcccgccgc
taccatgcgcgcgtgttcaccaccatcaacaccatcctgcacgacaacgagctggaaccc
gcgcgcaagctgatccatcagctgtacgatgccggcgtcgacgcgctgatcgtgcaagac
ctgggggtgatggagctggacatcccgccgatcgagctgcacgccagcacccagaccgac
atccgcaccctggaacgggccaagttcctcgaccaggccggtttctcccagctggtactg
gcccgtgagctgaacctgcagcaaatccgcgccatcgccgccgaaaccgacgctgccatc
gagttcttcatccacggtgcgctgtgcgtggcattctccggccagtgcaacatctcccac
gcgcagactggccgaagcgccaaccgtggcgactgttcgcaagcctgccgcctgccctac
accctgaaggatgaccagggtcgcgtggtagcgttcgagaagcacctgctgtcgatgaag
gacaacaaccagaccgccaacctggccgacctggtggatgctggcgtgcgctcgttcaag
atcgagggccgctacaaggacatgggctatgtgaagaacatcaccgcccactaccgcaaa
gagctcgacgccatcctcgaaggccgcccggaatatgcccgtgcgtccagcggccggacc
gaacacttcttcttgcccgacccggacaagaccttccaccgcggcagcaccgactatttc
gtgaccgaccgcaaggtcgacatcggtgccttcgactcgccaaccttcacaggcctgccg
gtgggtgtggtggaaaaggtcggcaagcgtgacatgcaagtggttaccgaggtgccactg
accaacggcgacggcctgaatgtgctggtcaaacgcgaagtggtgggtttccgcgccaac
atcgccgaaccacgtggcgaattcgaggaagacggccagaagcgctaccgctaccgcgtc
gagcccaacgaaatgcccgaaggcctgcacaagctgcggcccaaccacccgctgtcgcgc
aacctcgaccacaactggcagcaggccctgcaacgcacctcttccgagcgccgggttggt
gtggaatggcatgctgtactgcgcgagcagcgcttgatgcttaccctcagcagcgaggaa
ggcgtcagcgtgcaggtggccctggacggcccgttcggcgaggccaacaagccgcagcag
gccctggaccagttgcatgacctgctcggccagctgggtaccacgatgtaccacgccagc
agcatcgaactggacgcgccgcaggcgtacttcatccccaactcgcagctcaaggccctg
cgccgcgaagccatcgaggcgctgaccgaggcgcgtatcaaggcgcacccgcgtggcggg
cgcaaggccgaaaccacgccgccgccggtgtaccccgagtcgcacctttccttcctggcc
aacgtgtacaaccagaaggcccgcgacttctaccatcgccatggcgtgcagctgatagac
gcggcctacgaggcccatgaagaacacggtgaggtgccggtgatgatcaccaagcactgc
ctgcgcttctccttcaacctgtgccccaagcaggccaagggcgtgaccggcgtgcgcacc
aaggtggcaccgatgcagctgattcagggtgatgaagtgctgaccctgaagttcgactgc
aaaccgtgcgaaatgcatgtggtcggcaagatgaaaagccacatcatcgacctgccaacc
ccaggcagcgcggttgcccaggtggtggggcacatcagcccggaagacctgctgaaaacc
atcgtgcgcgcgccacactga

DBGET integrated database retrieval system