KEGG   Pseudomonas putida NBRC 14164: PP4_25860Help
Entry
PP4_25860         CDS       T02707                                 

Definition
(GenBank) putative nucleosidase
  KO
K01243  adenosylhomocysteine nucleosidase [EC:3.2.2.9]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
ppun00270  Cysteine and methionine metabolism
ppun01100  Metabolic pathways
ppun01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppun00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PP4_25860
Enzymes [BR:ppun01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     PP4_25860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: BAN54439
LinkDB All DBs
Position
2945204..2945791
Genome map
AA seq 195 aa AA seqDB search
MMLIKQFPDISLDDTLFVFALEAEAGDVFTEVNTVFTGIGKVNAAIALTKAIATRRPRLI
VNLGSAGSQRHGKGQVVCCNRFVQRDMDVTPLGFARYETPLSGVPVVLEHGAAIPGLPLE
TCGSGDSFEINHGEAPYDVVDMEAYVLALIARGEGIPFVCLKYISDDAGSDAAGDWAVQV
HLAAEAFKRVLFSQV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgatcaagcaattccccgacatttccctggatgacacgctgttcgtattcgcc
ctcgaggccgaggctggcgatgttttcacagaggtgaacaccgtgttcaccggcattggc
aaagtcaatgcggcgatcgcactgaccaaggcaattgcaacccgcaggcccagacttatc
gtcaaccttggctcggcgggcagccagcgccatggcaagggccaggtggtgtgctgtaac
cgtttcgtacaacgcgacatggacgtgacaccgctgggctttgcccgttacgaaacgccc
ttgtcgggtgtcccggtagtcctggaacatggcgcagcaatccccggcctgccgctggaa
acctgtggcagcggtgacagcttcgaaatcaaccatggcgaggcgccttatgacgtggtc
gacatggaagcctatgtgctggcgttgatcgcacgcggcgaaggcattccgtttgtgtgc
ctgaaatacatatccgatgatgccggcagcgatgccgcaggggactgggccgtgcaggtg
cacctggcggccgaggcattcaagcgggtgctgttcagccaggtttga

DBGET integrated database retrieval system