KEGG   Pseudomonas putida NBRC 14164: PP4_37520Help
Entry
PP4_37520         CDS       T02707                                 

Gene name
rlmL
Definition
(GenBank) 23S rRNA methyltransferase RlmL
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
ppun  Pseudomonas putida NBRC 14164
Brite
KEGG Orthology (KO) [BR:ppun00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ppun03009]
    PP4_37520 (rlmL)
Enzymes [BR:ppun01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     PP4_37520 (rlmL)
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     PP4_37520 (rlmL)
Ribosome biogenesis [BR:ppun03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PP4_37520 (rlmL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_25 Methyltransf_11 Methyltransf_15
Motif
Other DBs
NCBI-ProteinID: BAN55605
LinkDB All DBs
Position
complement(4266602..4268794)
Genome map
AA seq 730 aa AA seqDB search
MSDRFELYLTCPKGLESLLAEEAKGLGLDEVREHTSAIRGAADMETAYRLCVWSRLANRV
LLVLKRFSMKNADDLYDGVNAVDWADHLAADGTLAVEFSGHGSGIDNTHFGALKVKDAIV
DKLRNREGLRPSVEKIDPDVRVHLRLDRGEAILSLDLSGHSLHQRGYRLQQGAAPLKENL
AAAVLIRSGWPRIAAEGGALADPMCGVGTFLVEAAMIAADIAPNLKRERWGFSAWLGHVP
ALWRKVHDEAQARAQAGLAKPPLWIRGYEADPRLIQPGRNNVERAGLGDWVKIYQGEVST
FEPRPDQNQKGLVISNPPYGERLGDEASLLYLYQNLGERLRQACMGWEAAVFTGAPQLGK
RMGIRSHKQYAFWNGALPCKLLLFKVQPDQFVTGERREAQADNAEIREQAPVASEPARLS
EGAQMFANRLQKNLKQLGKWARREQVDCYRLYDADMPEYALAVDLYHDWVHVQEYAAPRS
IDPEKAQSRLLDALAAIPQALGISPQRVVLKRRERQSGTRQYERQATEGRFQEVNEGGVK
LLVNLTDYLDTGLFLDHRPMRMRIQREAAGKRFLNLFCYTATASVHAAKGGARSTTSVDL
SKTYLDWARRNLALNGFSERNRLEQGDVMAWLEANRDSYDLIFIDPPTFSNSKRMEGVFD
VQRDHVQLLDLAMARLAPDGVLYFSNNFRKFQLDEHLMARYAVEEITAQTLDPDFARNNR
IHRAWRLQLR
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaccgtttcgaactctacctcacctgccccaaaggcctcgaaagcctgcttgcc
gaagaggccaagggccttggccttgacgaggtgcgtgagcacacctcggccattcgcggc
gccgccgacatggaaaccgcctaccgcctgtgcgtatggtcgcgcctggccaaccgggtg
ctgctggtgctcaagcgcttctccatgaagaacgccgacgacctgtatgacggcgtcaac
gcggttgactgggccgaccacctggcagccgacggcaccctcgcggtggagttcagcggc
catggctcgggcatcgacaacacccacttcggtgcgctgaaggtcaaggatgcgatcgtc
gacaagctgcgcaaccgcgaaggcctgcgcccgtcggtggaaaagatcgaccctgacgtg
cgtgtgcacctgcgcctggaccgtggcgaggccattctttccctcgacctgtccggccac
agcctgcaccagcgcggctatcgcctgcagcaaggtgctgcgccgctgaaggaaaacctg
gcggcagcagtgctgatccgctcgggctggccgcgcattgccgccgaaggtggcgcactc
gccgacccgatgtgtggtgtgggtaccttcctggtcgaagcggcgatgatcgctgccgat
atcgcgcccaacctcaagcgtgaacgttggggtttcagtgcctggctcggccacgtgccg
gcgctgtggcgcaaggtacacgatgaggcgcaggcccgggcgcaggccggcctggccaag
ccaccgctgtggatccgcggttacgaagccgacccgcggctgatccagccgggccgcaac
aacgtcgagcgcgccggtctgggcgactgggtgaaaatctatcagggcgaggtcagtacc
ttcgagccacgcccggaccagaaccagaaaggcctggtcatcagcaacccgccctatggc
gagcgcctgggtgacgaagccagcctgctgtacctctaccagaacctgggcgagcgcctg
cgccaggcctgcatgggctgggaggcggcggtgttcaccggcgcgccgcagctgggcaag
cgcatgggtattcgcagccacaagcagtacgcgttctggaacggcgccttgccgtgcaag
ctgctgctgttcaaggtgcagcccgaccagttcgtgaccggtgagcgccgcgaagcgcag
gctgacaacgccgaaatccgtgagcaagcgccggtagccagtgagccggcgcgcctgtcg
gaaggcgcgcagatgtttgccaaccgcctgcagaagaacctcaagcaactgggcaagtgg
gcccgccgcgagcaggttgactgctaccgcctgtacgatgccgacatgcccgagtacgcc
ctggcggtcgacctgtaccacgactgggtgcatgtgcaggagtacgccgcgccacgttcg
atcgacccggagaaggctcaatcgcgcctgctcgatgccctggcagccatcccccaggca
ctgggtatttcgccgcagcgtgtagtgctcaagcgccgcgagcggcagagcggcacccgg
cagtacgagcgccaggccaccgagggccgcttccaggaggtgaacgaaggtggcgtcaag
ctgctggtcaacctcaccgactacctcgacaccgggctgttccttgaccaccgcccgatg
cgcatgcgtatccagcgcgaggctgccggcaagcgcttcctcaacctgttctgctacacc
gccacggcttccgtgcatgcggccaagggcggcgcacgcagcaccaccagcgtcgatttg
tcgaaaacctacctcgactgggcgcggcgcaacctggcgctcaatggcttttccgagcgc
aaccgcctggagcagggtgatgtgatggcatggctggaagctaaccgcgacagctacgac
ctgatcttcatcgacccgccaaccttctccaactccaagcgcatggaaggcgtgttcgat
gtgcagcgtgaccacgtacagctgctggacctggccatggctcgcctggccccggatggc
gtgttgtatttctccaacaacttccgcaagttccagctcgacgaacacctgatggcgcgc
tatgccgtggaagaaatcactgcccagacgctggacccggactttgcccgaaacaaccgg
atccaccgcgcctggcgcctgcaattgcgttga

DBGET integrated database retrieval system