KEGG   Pseudomonas putida NBRC 14164: PP4_39130
Entry
PP4_39130         CDS       T02707                                 

Gene name
htpX
Definition
(GenBank) protease HtpX
  KO
K03799  heat shock protein HtpX [EC:3.4.24.-]
Organism
ppun  Pseudomonas putida NBRC 14164
Brite
KEGG Orthology (KO) [BR:ppun00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ppun01002]
    PP4_39130 (htpX)
Enzymes [BR:ppun01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     PP4_39130 (htpX)
Peptidases and inhibitors [BR:ppun01002]
 Metallo peptidases
  Family M48: Ste24 endopeptidase family
   PP4_39130 (htpX)
SSDB
Motif
Pfam: Peptidase_M48 Peptidase_M56 Ldr_toxin SprT-like Myc_target_1 DUF3681 TssN Phage_holin_3_6 MHYT
Other DBs
NCBI-ProteinID: BAN55766
LinkDB
Position
4454752..4455639
AA seq 295 aa
MMRILLFVATNLAVVLVASITLSLFGFNGFMAANGVDLNLSSLLVFCAVFGFAGSLVSLF
ISKWMAKMTTGTQIISQPRTRHEQWLLQTVEELSREAGIKMPEVGIFPAYEANAFATGWN
RNDALVAVSQGLLERFSPDEVRAVLAHEIGHVANGDMVTLALVQGVVNTFVMFFARIIGN
FVDKVIFKNEEGQGIAYYVATIVAELILGILASMIVMWFSRRREYRADEAGAQLAGTSAM
IGALQRLRVEQGLPVHMPDTMKAFGINGGLKHGLAGLLMSHPPLEDRIEALRRRG
NT seq 888 nt   +upstreamnt  +downstreamnt
atgatgcgcattctgttgtttgtggccaccaaccttgcggtggtgctggttgcaagcatt
accttgagcctgttcggtttcaacgggttcatggccgccaacggggtcgacctgaacctc
agcagcctgctggtgttctgcgccgtgttcggctttgccggctccctcgtctcgctgttc
atctccaagtggatggcgaagatgaccaccggcacccagatcatcagccagccgcgcacc
cgccacgagcagtggctgctgcaaacggtcgaagagctgtcccgtgaagcgggcatcaaa
atgcccgaggtgggtatcttcccggcgtacgaggccaacgccttcgccaccggctggaac
cgcaacgacgcactggtcgccgtgtcccagggcctgctggagcgtttctcgcccgatgaa
gtgcgggcagtgctggcccacgagatcggccacgtagccaacggcgacatggtcaccctg
gcgctggtgcaaggcgtggtgaacaccttcgtgatgttcttcgcacgcatcatcggcaac
ttcgtcgacaaggtcatcttcaagaacgaagagggccagggcattgcctactacgtggcg
accatcgttgccgagctgatcctgggcatcctggccagcatgatcgtgatgtggttctcg
cgccgccgcgagtaccgcgccgacgaagccggtgcacagctggccggcacctcggccatg
atcggagcgctgcagcgcctgcgtgtggagcaaggcctgccggtgcacatgcccgacacc
atgaaggcctttggcatcaacggtggcctcaagcatggcctggccgggctgctgatgagc
cacccgccactggaagaccgtatcgaggccctgcgccgtcgcggttga

DBGET integrated database retrieval system