KEGG   Pseudomonas putida NBRC 14164: PP4_48740Help
Entry
PP4_48740         CDS       T02707                                 

Gene name
mrdA
Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
ppun00550  Peptidoglycan biosynthesis
ppun01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ppun00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PP4_48740 (mrdA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    PP4_48740 (mrdA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppun01011]
    PP4_48740 (mrdA)
Enzymes [BR:ppun01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PP4_48740 (mrdA)
Peptidoglycan biosynthesis and degradation proteins [BR:ppun01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   PP4_48740 (mrdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: BAN56727
LinkDB All DBs
Position
complement(5517899..5519788)
Genome map
AA seq 629 aa AA seqDB search
MSQPIRLKDHEKDARLVRNRVVVGAVAIVLLICVLIARLYYLQIIQYDYHSTLSENNRVH
VQPIPPTRGLIFDRNGVIVADNRPSFSLSMTRERAGNWQEVLDTIVEVLDLTTDDRALFE
KRMRQGRRPFEPVPILFELNEEQIARVAVNQFRLPGVEVVAQLVRHYPQGAHFAHSVGYV
GRINEKELKTLDPVNYSGTHHIGKTGIERFYEDDLHGQVGYEEVETNARGRVLRVLKRTD
PKPGKDIVLSLDIKLQEAAEAALGGRRGAVVALDPRTGEVLAMVSQPSFDPNLFVTGISF
KAYAELRDSIDRPLFNRVLRGLYPPGSTIKPAVAIAGLDSGVVNASSRVFDPGYYQLPNY
DHKYRNWNRSGDGWVDLDTAIMRSNDTYFYDLAHKMGIDRLSSYMNRFGIGQRVSLDMFE
ESAGLMPSREWKRATRRQAWFPGETLILGIGQGYMQATPLQLAQATALIANKGVWNRPHL
AKTIEGQQPVDENPMENIVLRDKSDWAKVTHGMEQVMHGARGTARKAAAGAQYRIAGKSG
TAQVVAIKQGEKYDRNKLQERHRDHALFVAFAPAEAPKIVVSVMVENGESGSGVAAPVVR
QIMDAWLLDENGRLKPEFAPATVTQESAL
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagccgatccgcctcaaggaccacgagaaagacgcccgcctggtgcgcaaccgc
gtcgtggtcggcgcggtggcgatcgtgctgcttatttgcgtgctgattgcgcggctgtac
tacctgcagatcatccagtacgactaccactcgacgctgtcggagaacaaccgggtgcat
gtgcagccgatcccgccgacccgcgggctgatcttcgaccgcaacggggtgatcgttgcc
gacaaccggcccagcttcagcctgtcgatgacccgcgaacgtgcgggtaactggcaggaa
gtgttggataccatcgtcgaagtgctggatttgacgaccgacgaccgggccctgttcgag
aagcgcatgcgccagggccgtcggccgttcgagccggtgccgatcctgttcgaactcaac
gaagagcagatcgcccgggtggcggtgaaccagttccgcctgccaggcgtggaagtggtg
gcccagctggtgcggcattacccgcagggtgcgcatttcgcccactcggtgggttatgtg
gggcgcatcaacgagaaagagctgaaaaccctcgacccggtgaactacagcggcacccac
catatcggcaagaccggcatcgagcgcttctacgaagacgacctgcacggccaggtcggc
tacgaggaagtcgagaccaacgctcggggccgcgtgctgcgggtgctcaagcgcacggac
ccgaaaccgggcaaggacattgtgctgagcctggacatcaagctgcaggaagccgccgag
gccgccctgggtggccggcggggcgcagtggtagcactcgacccacgtactggcgaggtg
ctggcgatggtcagccagccaagcttcgaccccaacctgttcgtcaccggcatcagcttc
aaggcctatgccgaactgcgcgactcgatcgaccggccgctgttcaaccgcgtactgcgt
ggcctgtacccgcccggttcgaccatcaagccggcggtggccatcgccggcctggacagt
ggcgtggtcaatgccagcagccgggtgttcgacccgggttattaccaactgcccaactat
gaccacaaataccgtaactggaaccgctccggcgatggctgggtcgacctggacaccgcg
atcatgcgttccaacgacacctacttctacgaccttgcgcacaagatgggcatcgatcgg
ctgtccagctacatgaacaggttcggcatcggtcagcgggtttccctcgacatgttcgag
gagtctgccggcttgatgccttcgcgcgaatggaagcgtgccacccgccgccaggcctgg
ttccctggtgaaaccctgattctcggtattggccagggctacatgcaggccacgccgctg
cagctggcccaagccactgcgctgatcgccaacaagggcgtgtggaaccgcccgcacctg
gccaagaccatcgaaggccagcagcctgtggacgaaaaccccatggaaaacatcgtgctg
cgtgacaagtccgactgggccaaggtcacccatggcatggagcaggtaatgcacggcgcc
cgcggtactgcgcgcaaggctgccgccggcgcccagtaccgcattgccggcaagagcggt
accgcccaggtggtggcgatcaagcaaggcgagaagtacgaccgcaacaagcttcaggag
cgccaccgcgaccacgccttgttcgtcgcctttgccccggccgaagccccgaaaatcgtg
gtatcggtgatggtcgagaacggtgagtccggctcgggcgtggctgcgcccgtggtacgc
cagatcatggacgcctggctgctcgacgaaaatggccggctcaagcccgagttcgcgcct
gccaccgttacccaggaatcggccctgtga

DBGET integrated database retrieval system