KEGG   Pseudomonas putida H8234: L483_05960Help
Entry
L483_05960        CDS       T02706                                 

Definition
(GenBank) cobalamin synthase
  KO
K02233  adenosylcobinamide-GDP ribazoletransferase [EC:2.7.8.26]
Organism
pput  Pseudomonas putida H8234
Pathway
pput00860  Porphyrin and chlorophyll metabolism
pput01100  Metabolic pathways
Module
pput_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:pput00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    L483_05960
Enzymes [BR:pput01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.26  adenosylcobinamide-GDP ribazoletransferase
     L483_05960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CobS
Motif
Other DBs
NCBI-ProteinID: AGN78162
UniProt: R9V010
LinkDB All DBs
Position
1289115..1289837
Genome map
AA seq 240 aa AA seqDB search
MLPFWIALQFLSSLPVSLPGMPEPRELGRSLLFYPLVGLLFGLLLWLASLLLQGTPAPLH
AALLLTLWVLLSGALHLDGLADSADAWLGGFGDRERTLQIMKDPRSGPIAVVTLVLVLLL
KFCALWVLVEQGIGAQLLLAPLIGRAAMLGLFLCTPYVRPGGLGQALAEHLPRRIAGWVL
LGSALFCLVLGGWVAVLALAMFAWLRHLICRCLGGTTGDTAGAMLELLELVVVLGLALGL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgttctggattgccttgcagtttctcagcagcttgcccgtgagcctgccgggc
atgccggagccgcgtgagctggggcgttcgctgctgttctacccgctggtcgggctgttg
ttcgggctactgctgtggctagccagccttctgctgcagggtacgccagcgccgctgcat
gcggcattgctgctgacgttgtgggtattgctcagtggcgccttgcacctggatggtctg
gctgacagtgccgacgcctggctgggtggtttcggcgaccgtgagcgcaccttgcagatc
atgaaagacccccgtagcgggccgattgccgtggtcaccctggtgctggtgctgttgctg
aagttttgcgccttgtgggtgttggttgagcagggcatcggggcgcagttgctgctggct
cccttgatcggccgggcggcgatgttgggcctgttcctctgtacaccctatgtgcggcct
ggcgggttgggccaggcgttggccgagcacttgccccgacgtatagccgggtgggtgctg
ctgggcagtgcgctgttctgcctggtcttgggcggctgggtggcagtgctggcgctggcc
atgtttgcctggttgcggcacctcatttgccgatgcctgggtggaactaccggggataca
gctggcgcgatgctggagttgctcgaactggttgtcgtgcttggattggcgctaggcctt
tga

DBGET integrated database retrieval system