KEGG   Pseudomonas putida H8234: L483_19180Help
Entry
L483_19180        CDS       T02706                                 

Definition
(GenBank) protein glxC
  KO
K22082  methylamine---glutamate N-methyltransferase subunit B [EC:2.1.1.21]
Organism
pput  Pseudomonas putida H8234
Pathway
pput00680  Methane metabolism
pput01100  Metabolic pathways
pput01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pput00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    L483_19180
Enzymes [BR:pput01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.21  methylamine---glutamate N-methyltransferase
     L483_19180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GXGXG VGPC1_C
Motif
Other DBs
NCBI-ProteinID: AGN82722
UniProt: R9VD01
LinkDB All DBs
Position
complement(4061625..4062299)
Genome map
AA seq 224 aa AA seqDB search
MKTIDLSSTSVRVLNQSLHGAVQDLEWQVTHPGGKHNLAVGINAAVAVDIEGHAGYYCAG
MNQQASVTVHGNVGVGVAENMMSGLVRVKGSASQAAGATAHGGLLVIEGDAGARCGISMK
GVDIVVGGSIGHMSCFMGQAGRLVVCGDAGDALGDSLYEVRIYVKGSVQSLGSDCIEKEM
RAEHLQELQELLNKAGLDHKAADFKRYGSARQLYNFKVDNASAY
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgatcgacctatccagcacttcggtgcgtgtgctcaaccagtcactgcacggc
gcggtgcaggacctcgaatggcaagtgacccatcccggcggcaagcacaacctggcggtg
ggcatcaacgccgccgtggcggtggatatcgaaggccatgccggctactactgcgccggc
atgaaccagcaggccagcgtgaccgtgcacggcaacgtgggtgtcggcgtggccgagaac
atgatgtccggcctggtgagggtcaagggcagtgcctcgcaggccgcaggcgccaccgcc
catggcgggctgctggtgatcgaaggtgatgccggtgcccgttgcggtatttccatgaaa
ggcgtggacattgtggtcggcggcagcattggccacatgagctgcttcatgggccaggcc
ggacgcctggtggtgtgtggcgatgccggcgacgcgctgggcgactcgttgtatgaggtg
cgcatctacgtcaagggctcggtgcagtcactgggctcggactgcatcgagaaagaaatg
cgcgccgaacacctgcaagagctgcaggaactgctgaacaaggctggcctggaccataag
gccgccgatttcaaacgctacggctcggcccgccagctgtacaacttcaaagtcgacaac
gccagcgcgtactga

DBGET integrated database retrieval system