KEGG   Pseudomonas putida H8234: L483_19370Help
Entry
L483_19370        CDS       T02706                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pput  Pseudomonas putida H8234
Pathway
pput00473  D-Alanine metabolism
pput01100  Metabolic pathways
pput01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pput00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    L483_19370
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    L483_19370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pput01011]
    L483_19370
Enzymes [BR:pput01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     L483_19370
Peptidoglycan biosynthesis and degradation proteins [BR:pput01011]
 Precursor biosynthesis
  Racemase
   L483_19370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DUF5604
Motif
Other DBs
NCBI-ProteinID: AGN82734
UniProt: R9VCM7
LinkDB All DBs
Structure
PDB: 

Position
complement(4108340..4109569)
Genome map
AA seq 409 aa AA seqDB search
MPFRRTLLAASLALLITGQAPLYAAPPLSMDNGTNALTVQNSNAWVEVSASALQHNIRTL
QAELAGKSRLCAVLKADAYGHGIGLVMPSIIAQGVPCVAVASNEEARVVRASGFTGQLVR
VRLASLSELEDALQYDMEELVGSAEFARQVDAIAARHGKTLRIHMALNSSGMSRNGVEMA
TWSGRGEALQITDQKHLKLVALMTHFAVEDKDDVRKGLAAFNEQTDWLIKHAKLDRSKLT
LHAANSFATLEVPEARLDMVRTGGALFGDTVPARTEYQRAMQFKSHVAAVHSYPAGNTVG
YDRTFTLARDSRLANITVGYSDGYRRVFTNKGHVLINGHRIPVVGKVSMNTLMVDVTDFP
DVKGGNEVVLFGKQAGGEITQAEMEEINGALLADLYTVWGSSNPKILVD
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccatttcgccgcaccctgctggccgcatccctggccctgctgatcaccggtcaagcc
cccctgtatgccgcacctccgctgtcgatggacaatggcaccaacgccctgaccgtgcag
aacagcaacgcctgggtcgaagtcagcgccagcgccctgcaacacaacatccgcaccctg
caggccgagctggctggcaagtccaggctgtgcgccgtgctcaaggccgacgcctatggc
cacggtatcggcctggtgatgccgtctatcattgcccagggcgtgccctgcgtggcggtg
gccagcaacgaggaggcccgcgtggtccgcgccagtggcttcaccgggcaactggtgcgg
gtacgcctggccagcctcagcgagctggaagatgccttgcagtacgacatggaagagctg
gtcggcagcgccgaatttgcccgccaggtcgatgccatcgccgcacgccacggcaagacc
ctgcgcatacatatggcgctcaactccagtggcatgagccgcaacggtgtggagatggcg
acctggtccggccgtggcgaagcgctgcagatcaccgatcagaagcacctcaagctggtt
gcgctgatgacccacttcgccgtcgaagataaggacgatgtccgcaagggcctggcggcc
ttcaacgagcagaccgattggttgatcaagcacgcgaagctcgaccgcagcaagctcacc
ctgcatgccgccaactcgttcgctaccctggaggtgccggaggcgcgcctggacatggta
cgcaccggcggcgcgctgttcggtgacaccgtgccggcgcgcaccgagtaccaacgcgcc
atgcagttcaagtcgcacgtggcggcggtgcacagttacccggccggcaacaccgtcggc
tacgaccgcaccttcaccctggcccgtgattcgcgcctggccaacatcaccgtcggttat
tccgatggctatcgccgggtgttcaccaacaagggccatgtgctgatcaacggccaccgc
ataccggtggtgggcaaggtgtcgatgaacacgctgatggtcgatgtcaccgacttcccg
gacgtgaagggcggcaacgaagtggtgctgttcggcaagcaggccgggggcgaaatcacc
caggccgagatggaagaaatcaacggcgcgctgctggccgacctgtacaccgtgtggggc
agttccaacccgaagatcctcgtcgactga

DBGET integrated database retrieval system