KEGG   Pseudomonas putida H8234: L483_19580Help
Entry
L483_19580        CDS       T02706                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
pput  Pseudomonas putida H8234
Pathway
pput00330  Arginine and proline metabolism
pput01100  Metabolic pathways
pput01110  Biosynthesis of secondary metabolites
pput01130  Biosynthesis of antibiotics
pput01230  Biosynthesis of amino acids
Module
pput_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pput00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    L483_19580
Enzymes [BR:pput01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     L483_19580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F420_oxidored P5CR_dimer IMPa_N_2
Motif
Other DBs
NCBI-ProteinID: AGN82762
UniProt: R9VD39
LinkDB All DBs
Position
4159874..4160656
Genome map
AA seq 260 aa AA seqDB search
MHSLGILGVGELTEKTVIGLRRSGFEGPILLSPRNAQRAAVLAQEHGCQVLASNQAVVDQ
AELVILGVRPQSLAELANDVQLRSGQRLVSLAAGVNLAQLSTAFPGALCVRAMLSYAAQY
NQSTVVVCPPDALTTQYLEPLGKLVVLQGEPEFELATVAACMNGWFYFLLHDLQQWLMDK
GLPATEARALVLGNLQDCVASAGQQPACTLKALGEAIATPGTFTADGLAVLMHQPVSATW
GAACEVVLDGLLTRSGRAGH
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcatagccttggcattctcggggtgggcgagctcaccgaaaaaacagtcatcggcctg
cgtcgcagcggtttcgaaggccccatcctgttgtcaccgcgcaatgcgcaacgggcagcc
gtgctggcccaggagcatggttgccaggtgctggcaagcaaccaggcagtggtcgaccag
gcagaacttgtgatccttggcgtgcgcccgcaatcgctcgccgaactggcaaatgacgta
cagctgcgctcaggccagcgcctggtctcgctcgccgccggggtcaaccttgcgcaactg
tccaccgcgttccctggtgccctctgtgtgcgtgcgatgctgtcgtatgcggcgcagtac
aaccagtccacggtagtggtgtgcccacccgatgcgctcactacgcagtacctggagcca
ctgggcaaactggtggtgctgcagggcgagccggaattcgagctggccaccgtggcggcg
tgcatgaatggctggttctacttcttgctacacgacctgcagcagtggctgatggacaaa
ggcctgcccgcaaccgaagcgcgtgcgctggtgctgggcaacctgcaagactgcgtggcc
agtgccgggcagcagccagcgtgtacgctcaaggccttgggcgaggccattgccacgccg
ggcacctttactgccgatggcctcgcggtgctgatgcatcagccggtaagcgccacctgg
ggcgcggcatgcgaggtggtgctagacgggctgttgacgcggtcagggcgggccgggcac
taa

DBGET integrated database retrieval system