KEGG   Pseudomonas putida H8234: L483_26760Help
Entry
L483_26760        CDS       T02706                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pput  Pseudomonas putida H8234
Brite
Enzymes [BR:pput01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     L483_26760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGN80399
UniProt: R9V613
LinkDB All DBs
Structure
PDB: 

Position
5670774..5671370
Genome map
AA seq 198 aa AA seqDB search
MAFELPPLPYAHDALQPHISKETLEFHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS
SGGIFNNAAQVWNHTFYWNCLSPNGGGQPTGALAEAINTAFGSFDKFKEEFTKTSVGTFG
SGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWAFVAEQFEGKTFKA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattgccgccgctgccgtacgcccacgatgccctgcagccgcacatctcc
aaggaaaccctggagtttcaccacgacaagcaccacaacacctatgtcgtgaacctgaac
aacctggtcccaggcaccgaattcgaaggcaagaccctggaagagatcgtcaagagctct
tcgggcggcatcttcaacaacgccgctcaggtctggaaccacaccttctactggaactgc
ctgtcgccaaacggcggcggccagcctaccggtgccctggctgaggccatcaacaccgct
ttcggttccttcgacaagttcaaggaagagttcaccaagacttcggttggcaccttcggt
tccggctggggctggctggtgaagaaagctgacggttccctggccctggccagcaccatc
ggcgccggctgcccgctgaccagcggcgacaccccgctgctgacctgcgacgtctgggaa
cacgcctactacatcgactaccgcaacctgcgtccgaagtacgtcgaggcgttctggaac
ctggtcaactgggccttcgttgccgagcagttcgaaggcaagaccttcaaggcctga

DBGET integrated database retrieval system