KEGG   Pseudomonas sp. UW4: PputUW4_00342Help
Entry
PputUW4_00342     CDS       T02357                                 

Gene name
maeB
Definition
(GenBank) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu00620  Pyruvate metabolism
ppuu01100  Metabolic pathways
ppuu01120  Microbial metabolism in diverse environments
ppuu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PputUW4_00342 (maeB)
Enzymes [BR:ppuu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     PputUW4_00342 (maeB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M AlaDh_PNT_C ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: AFY17550
UniProt: K9NEB5
LinkDB All DBs
Position
379800..381068
Genome map
AA seq 422 aa AA seqDB search
MSDLKTAALEYHANPRPGKLSVELTKATATARDLSLAYSPGVAEPVREIARDPELAYKYT
GKGNLVAVISDGTAILGLGNLGPLASKPVMEGKGVLFKRFAGIDVFDIEVDSESPQAFID
TVKRISITFGGINLEDIKAPECFEIERALIEQCDIPVFHDDQHGTAIVTAAGMINALEIA
GKTLPEAKIVCLGAGAAAISCMKLLVSMGANIENIYMVDRTGVIHSGRDDLNQYKAVFAH
ATDKRTLADALQGADVFVGLSGPNLLSAEGLLSMAPNPIVFACSNPDPEISPELAHATRS
DVIMATGRSDYPNQVNNVLGFPFIFRGALDVRAKRINEEMKVAAANALRELAKLPVPQEV
CDAYGGIKLEFGREYIIPKPMDARLITLISDAVAKAAIETGVATLPYPKNYPLKSVDDVF
NG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatctgaaaactgccgctctcgaatatcacgccaatcctcgtccagggaagctg
agtgtcgagctcaccaaggccactgctaccgctcgcgacctgtcgctggcctacagcccg
ggcgtagccgagccagtacgcgagatcgcccgcgatcccgagctggcctacaagtacacc
ggcaaaggcaacctggttgcagtcatttccgatggcaccgcgattctcggcctgggtaac
ctcggcccattggcttccaagccagtgatggaaggtaaaggcgtactgttcaagcgcttc
gccggcatcgacgttttcgacatcgaagtcgactccgaaagcccgcaggccttcatcgac
accgtcaagcgcatctccatcaccttcggtggcatcaacctggaagacatcaaggcaccc
gagtgctttgaaatcgaacgcgctctgatcgagcagtgcgatattccagtattccacgat
gaccagcacggcaccgctatcgtgaccgcggccggcatgatcaacgccctggaaatcgct
ggcaaaaccctgccggaagccaagatcgtctgcctgggtgccggcgccgccgccatctcc
tgcatgaagttgctggtgagcatgggcgcgaacatcgaaaacatctacatggtcgaccgt
accggtgtgatccactccggccgtgacgacctgaaccagtacaaggctgtgttcgctcac
gcgaccgacaagcgcaccctggctgacgccctgcaaggcgctgacgtgttcgttggtctg
tccggcccgaacctgctgagtgctgaaggcctgctgtcgatggcgccgaacccgatcgtg
ttcgcgtgctccaaccctgatccggaaatctccccggagctggcgcacgccacccgtagc
gacgtgatcatggcgaccggtcgttccgactacccgaaccaggtcaacaacgtactgggc
ttcccgttcatcttccgtggtgccctggacgttcgcgccaagcgcatcaacgaagaaatg
aaagtggctgcggccaacgccctgcgtgaactggccaagctgccagtgcctcaggaagtg
tgcgacgcctatggcggcatcaagctggaattcggtcgtgagtacatcattccgaagcca
atggatgcccgtctgatcaccctgatctccgatgccgtggctaaagccgccatcgagacc
ggtgtggcgaccctgccgtatccgaagaactacccgctgaaaagcgtggatgatgtgttc
aacggctaa

DBGET integrated database retrieval system