KEGG   Pseudomonas sp. UW4: PputUW4_01057Help
Entry
PputUW4_01057     CDS       T02357                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu00620  Pyruvate metabolism
ppuu00680  Methane metabolism
ppuu01100  Metabolic pathways
ppuu01120  Microbial metabolism in diverse environments
ppuu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PputUW4_01057 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    PputUW4_01057 (ppc)
Enzymes [BR:ppuu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PputUW4_01057 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFY18264
UniProt: K9NEQ4
LinkDB All DBs
Position
1254255..1256885
Genome map
AA seq 876 aa AA seqDB search
MTDIDARLREDVHLLGELLGNTIREQYGDGFLDKIEQIRKGAKADRRGSMDAELSASLNQ
LTEDELLPVARAFNQFLNLANIAEQYQLIHRREASQQAPFEARVLPELLARLRAEGHGAE
ALARQLGRLEIELVLTAHPTEVARRTLIQKYDAIAAQLAAQDHRDLTSAEREQIKTTLQR
LIAEAWHTEEIRRTRPTPVDEAKWGFAVIEHSLWQAIPNYLRKADQALHAATGLHLPLEA
APIRFASWMGGDRDGNPNVTAAVTREVLLLARWMAADLYLRDVDQLAAELSMQQASDELK
AKAGDSAEPYRAVLKQLRERLRATRNWAHTSLSTPTPAPADVLQNNRELLDPLELCYHSL
HECGMGVIADGPLLDCLRRAVTFGLFLVRLDVRQDSSRHTAAMTEITDYLGLGRYEDWGE
EERIAFLMRELNNRRPLLPAYFKPSADTAEVLATCREIAAAPGASLGSYVISMAGAASDV
LAVQLLLKESGVLRPMRVVPLFETLADLDNAGPVIEKLLLLPGYRSRLQGPQEVMIGYSD
SAKDAGTTAAAWAQYRAQERLVDICREQQVELLLFHGRGGTVGRGGGPAHAAILSQPPGS
VAGRFRTTEQGEMIRFKFGLPDIAEQNLNLYLAAVLEATLLPPPPPTPEWRHLMDELAAD
GVSAYRAVVRENPQFVEYFRQSTPEQELGRLPLGSRPAKRRAGGIESLRAIPWIFGWTQT
RLMLPAWLGWEAALSKALERGEGELLGQMREQWPFFRTRIDMLEMVLAKADADIARSYDE
RLVEPNLLPLGAHLRDLLSQACSIVLGLTGQSQLLAHSPATLEFIRLRNTYLDPLHLLQA
ELLARSRLQDVAQGSPVEQALLVSVAGIAAGLRNTG
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattgatgcacgcttgcgcgaggacgttcacctgttgggtgagctgttgggc
aacaccattcgtgaacaatatggcgacggttttctcgacaagatcgagcagatccgcaag
ggcgccaaggcggaccggcgcggctccatggacgccgagctcagcgccagcctcaaccag
ttgaccgaagatgaactgttgccggtagcgcgggcgttcaatcagtttctcaacctggcc
aatatcgccgagcaataccagttgattcaccgtcgggaggcgtctcaacaggcgccgttc
gaagcccgggtgttgcccgaattgctcgctcgcctgcgtgccgagggtcatggtgccgaa
gcactggcccggcaattggggcgactggagattgagctggtgctgaccgcgcacccgacc
gaagtcgcgcgccgcacgctgatccagaagtacgacgccatcgccgcgcaactggcggct
caggatcaccgcgacttgaccagtgccgagcgcgagcagatcaaaaccaccttgcagcgc
ctgatcgccgaagcctggcacaccgaggaaatccgccgcacgcgtccgacaccggtggac
gaagccaagtggggtttcgcggtgatcgagcattcgctgtggcaggccattcccaattac
ctgcgcaaggccgaccaggccctgcacgctgccaccggtctgcacttgccactggaggcg
gcgccgattcgctttgcctcgtggatgggcggcgaccgcgacggcaaccccaatgtgacg
gcggcggttacccgagaggttttactgttggcgcgctggatggcggctgatctgtacctg
cgcgatgtcgatcagctggcggctgagctgtcgatgcagcaggccagcgatgaattgaag
gccaaggcgggtgacagcgccgaaccttaccgggctgtgctcaaacagctgcgcgaacgc
ctgcgggcgacgcgcaactgggcgcacacctcgttgtcgacacccacgccggcaccggcc
gacgtgctgcaaaacaaccgcgaactgctcgacccgctggagctgtgctaccactcgctg
catgaatgcggcatgggcgtgatcgccgacggaccgttgctcgactgcctgcgccgggcg
gtgacctttggcctgttcctggttcgtctggatgtgcgccaggactcgtcgcgacacacc
gctgccatgaccgaaatcaccgactacctcggcctggggcgctacgaggactggggcgag
gaagaacgcatcgccttcctgatgcgcgaactgaataaccgccggccgttgttgccggcg
tacttcaagccctctgccgataccgccgaggtgctggcgacctgccgggaaattgccgct
gcaccgggggcgtccctcggttcctatgtgatctcgatggccggtgccgcttccgatgtg
ctggcggtgcaattgttgctcaaggaatccggcgtgctgcggccgatgcgcgtggtgccg
ctgttcgaaaccttggccgatctcgacaacgccggtccggtgatcgagaagctgctgctg
ttgccgggctatcgctcgcgtctgcaaggtccgcaggaagtgatgatcggctattccgat
tcggccaaggacgccggcaccaccgcggcggcctgggcgcagtaccgggcgcaggaacga
ctggtggatatctgccgcgaacaacaagtggaactgctgctgttccacggccgcggcggc
acagtggggcgtggcggcggaccggcccacgcggcgatcctgtcgcagccgccgggttcg
gtggcggggcgcttccgcaccaccgaacagggtgaaatgattcgattcaaattcggcctg
ccggacatcgccgagcaaaacctcaacctgtacctggccgccgtgcttgaggcgaccttg
ctgccgccgccgccaccgacgcccgagtggcgccatttgatggacgaactggccgccgat
ggtgtcagcgcttaccgcgccgtggtgcgggaaaatccgcagttcgtggagtatttccgc
cagtccacgccggaacaggaactcggtcgtttgcccctgggcagtcgcccggccaagcgc
cgggccggggggatcgaaagcctgcgggcgattccgtggatcttcggctggacccagacg
cgtctgatgctgccggcctggctgggttgggaagccgccctgagcaaggcgctggagcgt
ggtgaaggtgaactgctggggcagatgcgtgagcaatggccgttcttccgcacccgcatc
gatatgctggagatggtcctggccaaggcggatgccgacattgcccggtcttatgacgag
cgtctggtggagccgaatctgttgccattgggtgcgcacttacgcgacctattgtcgcag
gcatgctccatcgttctcggcctgaccgggcagtcgcagctgctggcacatagcccagcg
acccttgaattcatccgcttgcgcaacacctacctcgacccgcttcatctattgcaggcc
gagttgctggcccgttcacgattgcaggatgtcgcgcagggcagcccggtagaacaggcc
ctgctggtgtctgtcgcggggattgccgccggtttgcgtaacaccggctaa

DBGET integrated database retrieval system