KEGG   Pseudomonas sp. UW4: PputUW4_02417Help
Entry
PputUW4_02417     CDS       T02357                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ppuu  Pseudomonas sp. UW4
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PputUW4_02417 (ahpF)
Enzymes [BR:ppuu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PputUW4_02417 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored Thi4 FAD_binding_3 DAO K_oxygenase AlaDh_PNT_C Glutaredoxin NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AFY19615
UniProt: K9NK88
LinkDB All DBs
Position
2822408..2823970
Genome map
AA seq 520 aa AA seqDB search
MLDTNLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLELLKDVASLSTQITLLDNGDDAR
KPSFSINRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIEQIRSLKGEFNF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVDERQIMAVPSIYLNGVNF
GQGRMGLEEILAKIDTSGIERQAEKISAKQAFDVLVVGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLAVALEEHVKQYDVDIMNLQRADKLVPGKNGEL
HQIHFASGASLKAKTLILATGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLLEFDVQLRADAVLQRKLHSLPNVTVITSAQTTEVTGDGQ
KVNGLRYKDRQSDEVRSVELEGIFVQIGLLPNTDWLKGTIELSPRGEIIVDARGETSVPG
VFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacaccaatcttaaagcccagttgaaatcgtacctggaacgggtcacccagccg
atcgagatagttgcttccctcgacgacggtgcgaaatcccaggaaatgctcgaactgttg
aaagacgttgccagtctttccacccagattactttgctcgacaacggtgatgatgcacgc
aagccatcgttctcgatcaatcgcccgggagccgacatcagcctgcgtttcgccggcatc
ccgatgggccatgaattcacttcgctggtgctggccttgttgcaagtcggcggtcatccg
tccaaggccagtgtcgaggtgattgaacagatccgttcgctcaaaggtgagttcaacttc
gagacttacttctcgctgtcgtgccagaactgcccggacgtggtccaggcgctgaacctg
atggcggtactgaacccgaacattcgccacgtcgccatcgacggtgcactgttccaggct
gaagtcgatgagcgccagatcatggcggtcccaagcatctacctcaatggtgtgaatttc
ggtcagggccgcatgggcctggaagaaatcctcgcgaagatcgacaccagcggcattgag
cgtcaggccgagaaaatcagcgccaagcaagcttttgatgtgctggtggtcggcggtggc
ccggccggtgcttcggcggccatctatgcggcccgtaaaggcattcgcaccggcgtcgcg
gccgagcgttttggtggtcaggtgctggacaccatggccatcgaaaacttcatctcggtg
caggaaaccgaagggccgaaactggccgtggccctggaagaacacgtcaagcagtacgac
gtggacatcatgaatctgcaacgtgccgacaaactggtgcccggcaaaaatggcgagttg
caccagattcacttcgccagcggcgcatcgctcaaagccaagaccttgattctggcgacc
ggagcgaggtggcgtgaaatgaacgtcccgggcgagcaggaataccgcaacaaaggcgtg
gcgtactgcccgcactgcgacggtccgctgttcaagggcaagcgcgtggcagtgattggc
ggcggtaactccggcgtcgaagcggccatcgacctggcgggtatcgtgtcccacgtcacg
ctgctggagttcgacgttcagttgcgcgccgatgcggtgttgcagcgcaagttgcacagc
ctgccgaacgtcaccgtgatcaccagtgcgcaaaccaccgaagtcaccggcgacggccag
aaggtcaacggcctgcgctacaaggatcgccagagcgacgaagtgcgcagtgtggaactg
gaaggaatttttgtgcagatcggtttgctgcccaacaccgattggctcaagggcaccatt
gagctgtcaccccgtggcgagatcattgttgacgctcgcggtgaaacgtcggtgccgggt
gtgttcgccgccggcgacgtgaccactgtgccgtacaagcagatcgtgattgcggtgggc
gagggcgccaaggcttcgctaagcgccttcgatcacctgatccgcacgtccgccccggca
taa

DBGET integrated database retrieval system