KEGG   Pseudomonas sp. UW4: PputUW4_02800Help
Entry
PputUW4_02800     CDS       T02357                                 

Gene name
treS
Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
ppuu00500  Starch and sucrose metabolism
ppuu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PputUW4_02800 (treS)
Enzymes [BR:ppuu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PputUW4_02800 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PputUW4_02800 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap APH
Motif
Other DBs
NCBI-ProteinID: AFY19995
UniProt: K9NLB5
LinkDB All DBs
Position
complement(3275639..3278980)
Genome map
AA seq 1113 aa AA seqDB search
MAKKPKAATFIKDPLWYKDAVIYQVHVKSYFDSNNDGIGDFPGLIAKLDYIADLGVNTIW
LLPFYPSPRRDDGYDIAEYRGVHSDYGTMADARRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARKAKPGSAARDFYVWSDDDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKAVLSVMRYWLDMGIDGLRLDAIPYLIERDGTNNENLPETHDVLKQIRA
EIDANYPDRMLLAEANQWPEDTQLYFGDTDKKGLNGDECHMAFHFPLMPRMYMALAQEDR
FPITDILRQTPDIPANCQWAIFLRNHDELTLEMVTDKERDYLWNYYAADRRARINLGIRR
RLAPLVERDRRRVELLNSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRN
GGFSRADPASLVLPPIMDPQYGYLSVNVETQAGDPHSLLNWTRRMLAVRKQSKAFGRGTL
KMLSPSNRRILAYTREYTGVDGKHEVILCVANVSRSAQAAELDLSAYVGMVPVEMLGGNA
FPPIGQLNFLLTLAPYGFYWFGLAAENQMPSWHVEPAQSLPDFTTLVLKKRMEELLEAPS
RHTLEQSILPSWLQNRRWFAGKDAAIEQVDLAYGVRFGDEQHPVLFSEINVTSGGQSSRY
QLPFGFISEDQVGTPLPQQLALSRVRRGRQVGLITDAFSLETFVHAVLQGIQAGTVLPSS
DGDIRFEATAELEKLGLNAESPVRYLSAEQSNSSVVIGNNMVLKLIRKIASGVHPELEMS
AYLTEAGFSNISPLLGAVVRRDGAGEDNLLMIAQGYLSNQGDAWEWTQNNLERALRDELA
DAMSEQEQHYNALGELKDFAGMLGRRLGEMHQVLAAPNANPDFLPQVTTQKEALASARDV
ATQIEHALNLLKQHQNQLSPADQTLVSRLLDNKKAILGHVQALGKKTAGGLRIRVHGDLH
LGQVLVIKGDAYLIDFEGEPARPLHERRGKHSPYKDVSGVLRSFDYAAAMAINVHNVDNT
AAADAARVRVTERYLSEARTAFVDAYRLAAASLAHAWQDPEGEDAALALFGLEKAAYEVA
YEAENRPTWLPVPLHGLYGLLSGLKPFSDLGGE
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaacccaaggcagccacgttcatcaaggacccgctctggtacaaggatgcg
gtgatctatcaagtacacgtcaaatcgtatttcgactccaacaacgacgggatcggcgac
tttcccggcctcatcgccaagctcgactacatcgccgacctgggcgtcaacaccatctgg
ctgttgcccttctatccctcgccacggcgcgacgacggttatgacatcgccgagtaccgc
ggcgtgcacagtgactacgggaccatggccgatgccaggcgtttcattgccgaggcacac
aaacgcggcctgcgggtgatcaccgaactggtcatcaaccacacctccgaccagcacccg
tggttccagcgtgcacgcaaggccaaacccgggtcggcggcgcgggacttctacgtgtgg
tccgacgacgatcagaaatacgacgggacccgcatcatctttctcgatacagagaagtcc
aactggacctgggacccggtcgccggccaatacttctggcaccgtttctactcccaccag
ccggacctgaatttcgataacccgcaagtcatgaaagcggtgctgtcggtgatgcgttac
tggctcgacatgggcatcgacggcttgcgcctggatgcgattccctacctgatcgagcgc
gacggcaccaacaacgaaaacctgccggaaacccacgatgtcctgaaacagatccgcgcc
gaaatcgacgccaattaccccgaccgcatgctgctggcggaagccaatcagtggccggag
gacacccagttgtacttcggcgacaccgacaagaaaggcctgaacggcgacgaatgccac
atggcctttcacttcccgttgatgccgcgcatgtacatggcgctggcccaggaagatcgc
ttcccgatcaccgatattctgcgccagaccccggatattcctgccaactgccaatgggca
atcttcctgcgcaaccacgatgaactgacgctggagatggtcaccgacaaggaacgcgac
tacctgtggaattactacgccgccgaccgtcgcgcgcggatcaacctggggattcgccgg
cgcctcgcgccgctggtggagcgtgaccgacgccgggtcgaactgctcaacagcctgttg
ctgtcgatgcccggcacgccgaccctgtattacggcgacgagattggcatgggtgacaac
atctacctcggcgaccgcgatggcgtgcgtacgccgatgcaatggtccatcgaccgcaac
ggcggtttctcccgtgccgacccggccagcctggtgctgccaccgatcatggacccgcaa
tacggttacctgtcggtcaatgtcgaaacccaggccggcgacccgcattcactgttgaac
tggacccggcgcatgctcgccgtgcgcaagcaatccaaggccttcgggcgcggtacattg
aagatgctgtcgccgagcaaccggcgaattctggcctacacccgtgaatacaccggggtg
gacggtaaacacgaagtcatcctgtgcgtggccaacgtgtcgcgcagtgcccaggccgcc
gagctagatttgtcggcctacgtcggcatggtgccggtggagatgctcgggggtaacgcc
ttcccgcccatcggccagctgaatttcctcctgaccctcgcgccctacggcttttactgg
ttcggcctcgccgcggaaaaccagatgcccagctggcatgtggaacctgcacaaagcctg
ccggacttcaccacgctggtgctgaaaaaacgcatggaggaactgctcgaagcgccgtca
cgccacacccttgagcaaagcatcctgcccagctggttgcagaatcgtcgctggttcgcc
ggcaaggacgccgccatcgagcaggtcgatctggcctacggcgtgcgcttcggcgatgag
cagcatccggtgctgttcagtgagatcaatgtcaccagcggtggccagagcagtcgctat
cagttgccgttcggctttatttcagaggatcaggtcggtacgccgctaccgcagcagctg
gcactgtcgcgggtacggcgtggacgccaggtcggcctgatcaccgatgccttcagcctg
gaaaccttcgtgcatgccgtattgcaagggattcaggccggtaccgtattgccctccagc
gatggcgacattcgcttcgaggccaccgccgaactggaaaaactcggcctcaatgccgag
tcgccggtgcgctacctgtcggcggaacagtccaacagctcggtggtgatcggcaacaac
atggtgctcaagctgatccgcaagatcgccagtggcgtgcatcctgaactggaaatgagt
gcctacctgaccgaagccgggttcagcaatatctcaccactgctgggggccgtagtgcgc
cgggacggggcgggtgaagacaacctgctgatgatcgcccagggctacctgagcaaccag
ggcgatgcctgggaatggacgcaaaacaacctcgaacgggcgctgcgcgatgaattggcc
gacgccatgtccgagcaggagcaacactacaacgcgctcggcgaactgaaagatttcgcc
ggtatgctgggccggcgcctgggggaaatgcatcaggtgctggcagcgcccaatgccaac
ccggacttcttgccgcaggtcaccacgcagaaggaggcgctggcttcggccagggatgtc
gcaacgcaaatcgagcacgcgctgaacttgctcaagcagcatcaaaatcaattgagcccg
gcggaccagaccctggtcagccgtttactggacaacaaaaaagccattctcggacatgtg
caagcgttgggcaaaaagactgcaggcggcttgcgcattcgtgtgcacggtgacctgcat
ctgggccaggtgctggtgatcaagggcgatgcgtacttgatcgacttcgagggagaaccg
gcgcggcccttgcatgaacgtcggggcaaacacagcccgtacaaggatgtcagtggcgtg
ctgcgttccttcgactatgcggcggccatggcgatcaacgtgcacaacgtcgataacacg
gcggcggccgatgccgcgcgtgtgcgggtcaccgagcgctacttgagtgaagcgcgaaca
gcatttgtcgacgcctatcggctggcggcagctagtcttgcccatgcatggcaagatccc
gaaggcgaggacgccgcgctggcgttgttcggtctggagaaggcggcgtatgaagtggcc
tatgaggcggaaaatcgccccacctggttgcccgtgccgttgcacggtttatatggatta
ttgagtgggcttaaacccttttccgatcttggtggagagtag

DBGET integrated database retrieval system