KEGG   Pseudomonas parafulva: NJ69_01970Help
Entry
NJ69_01970        CDS       T03520                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ppv  Pseudomonas parafulva
Pathway
ppv00620  Pyruvate metabolism
ppv00680  Methane metabolism
ppv01100  Metabolic pathways
ppv01120  Microbial metabolism in diverse environments
ppv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NJ69_01970
  09102 Energy metabolism
   00680 Methane metabolism
    NJ69_01970
Enzymes [BR:ppv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     NJ69_01970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIZ31863
UniProt: A0A0A7JH40
LinkDB All DBs
Position
445554..448181
Genome map
AA seq 875 aa AA seqDB search
MTDIDVRLREDVHLLGELLGETIRQQHGEGFLQKIEDIRHSAKADRRGAGEQLSSTLADL
ADDDLLPVARAFNQFLNLANIAEQYQLIHRRGAEQQAPFEDRALPELLARLRQAGHDDQS
LARQLAELDIQLVLTAHPTEVARRTLIQKYDAIAAQLAAQDHRDLTPAERQRIRERLRRL
IAEAWHTEEIRRTRPTPVDEAKWGFAVIEHSLWQAIPNHLRKVDQALFDATGQRLPLSAA
PIRFASWMGGDRDGNPNVTAPVTREVLLLARWMAADLFLRDIDALAADLSMQQASAALRE
VVGDSAEPYRAVLKQLRDRLRATRAWAHASLAGPQPASAQVLGNNRELIEPLERCHQSLH
DCGMGVIADGPLLDCLRRAVTFGLFLVRLDVRQDAARHRDALSEITDYLGLGRYADWDEE
QRIAFLQAELANRRPLLPDYFQPEADTAEVLATCREIAAAPAASLGSYVISMAGAASDVL
AVQLLLKEAGLTRPMRVVPLFETLADLDNAGPVMERLLGLPGYRDTLHGPQEVMIGYSDS
AKDAGTTAAAWAQYRAQENLVRICREHEVELLLFHGRGGTVGRGGGPAHAAILSQPPGSV
AGRFRTTEQGEMIRFKFGLPGIAEQNLNLYLAAVLEATLLPPPPPEPAWREVMDQMAADG
VQAYRAVVRENPDFVEYFRQSTPEQELGRLPLGSRPAKRRAGGIESLRAIPWIFGWTQTR
LMLPAWLGWESALSNALARGQGDLLTQMRAQWPFFRTRIDMLEMVLAKADAEIAKAYDER
LVQPQLLALGSHLRDLLSQSCQVVLSLTGQPVLLAHSPETLEFISLRNTYLDPLHRLQAE
LLARSRVREAALDSPLEQALLVTVAGIAAGLRNTG
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcgatgtgcgcttgcgtgaagatgtccacctgctgggtgagctgctcggg
gaaaccattcgccagcagcatggcgaaggttttttgcagaagatcgaggacattcgccac
agtgccaaggccgatcgccgcggtgcgggcgagcaattgagttccacccttgccgatctg
gccgatgacgacctgttgccggtggcccgtgcgttcaaccagttcctcaacctggccaac
atcgccgagcagtaccagctgatccatcggcgcggtgccgagcagcaggcgccgttcgaa
gaccgcgccttgccggaactgctggcacggctgcgccaggccgggcatgacgatcagagc
ctggcccggcagttggccgaactggacatccagttggtgctgacggcgcaccccaccgaa
gtggcgcggcgcaccttgatccagaagtacgatgcgattgccgcccaactcgccgcccag
gaccaccgcgacctcacgcccgccgagcgccagcggattcgtgagcggttgcgccgcctc
atcgccgaggcctggcataccgaggagatccgtcgtacccggcccaccccggtcgatgaa
gccaagtggggctttgcagtgatcgagcactcgctgtggcaggccattcccaaccacctg
cgcaaggtcgaccaggccttgttcgacgccaccggccagcggctgccgctgagcgccgcg
ccgatccgcttcgcctcatggatgggcggtgaccgcgacggcaaccccaacgtcaccgcg
cctgtaacccgtgaggtactgctgttggcgcgctggatggcggctgacctgttcctgcgc
gacatcgatgcgctggcggcggatttgtccatgcagcaggccagcgccgcgctgcgtgaa
gtggtcggtgacagcgccgagccctatcgcgcggtgctcaagcaactgcgcgatcgcctg
cgcgccacccgcgcctgggcccatgcctccttggccgggccacagcctgcttcggcacag
gtgctgggcaacaaccgcgaactgatcgagcccctcgagcgatgccatcagtcgctgcat
gactgcggcatgggcgtgatcgccgacggcccgctgcttgactgtctgcgccgggcggtg
acctttggcctgttcctggtgcgcctggacgtgcgccaggacgcagcccgacaccgcgat
gcactgtcggaaatcaccgactacctggggctgggacgctacgccgactgggacgaagag
cagcgcatcgccttcctgcaagccgaactggccaatcgtcgacccctgctgcctgactat
ttccagcccgaggcggacaccgccgaggtgctggcgacctgtcgcgagatcgcggcggcg
cccgctgcctcgctgggctcctacgtgatttccatggccggtgcggcctccgatgtgttg
gcagtgcaattgctgttgaaggaagccggactgacccggcccatgcgcgtggtgccgctg
ttcgagaccctggccgatctggacaacgccggcccggtgatggagcgcctgctcggtttg
cccggttatcgcgacacgctgcacggtccgcaggaagtgatgatcggctattccgactcg
gccaaggacgccggcaccacggcggcggcctgggcgcagtaccgcgcacaggaaaacctg
gtacggatctgtcgtgaacatgaggtcgaattgctgctgttccatggccgcggcggcacc
gtcgggcgtggcggtggtcctgcccacgcggcgatcctgtcgcagcccccgggctcggtg
gccggacgcttccggaccaccgagcagggcgaaatgatccgcttcaagttcggcctgccg
ggcatcgccgaacagaacctcaacctgtatctggcggcggtgctggaggcgaccttgctg
ccgcctccgccgccggagcccgcctggcgcgaggtgatggaccagatggccgccgacggc
gtgcaggcctaccgcgcggtggtgcgcgagaacccggatttcgtcgagtatttccggcag
tccacgcccgagcaggaactgggacgtctgccgttgggtagccggcctgccaagcgccgc
gccgggggcatcgagagtctgcgggcgatcccgtggatcttcggctggacccagacacgg
ctgatgctgccggcctggctgggctgggaaagcgcattgagcaacgcactggcccggggg
cagggtgacctgctgacgcagatgcgtgcgcagtggccgttcttccgtacgcgtatcgac
atgctggagatggtcttggccaaggccgatgcggaaatcgccaaagcctacgacgaacgt
ctggtgcaaccgcaactgctggcgttggggtcgcatctgcgcgacctattgtcgcagtcg
tgccaggtggtgctgagcctgaccggccagccggtgctactggcccacagtcccgagacc
ctggaattcatcagcttgcgcaacacctacctggaccccctgcatcgcctgcaggcggaa
ctgctggcccgctcgcgggtgcgcgaagccgctctggatagcccattggagcaggccctg
ctggtcaccgtggccggcattgcggcgggtttgcgcaacaccggctga

DBGET integrated database retrieval system