KEGG   Pseudomonas parafulva: NJ69_06360Help
Entry
NJ69_06360        CDS       T03520                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ppv  Pseudomonas parafulva
Pathway
ppv00500  Starch and sucrose metabolism
ppv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NJ69_06360
Enzymes [BR:ppv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     NJ69_06360
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     NJ69_06360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AIZ32650
UniProt: A0A0A7JMA2
LinkDB All DBs
Position
1426540..1429851
Genome map
AA seq 1103 aa AA seqDB search
MAKRSRPAAFIDDPLWYKDAVIYQLHIKSFFDANNDGIGDFAGLISKLDYIAALGVNTLW
LLPFYPSPRRDDGYDIAEYKSVHPDYGSLADARRFIAEAHRRGLRVITELVINHTSDQHP
WFQRARRAKRGSKARDFYVWSDDDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKAVIGVMRFWLDLGVDGLRLDAIPYLIERDGTNNENLPETHRVLKAIRA
EIDANYPDRMLLAEANQWPEDTRPYFGEGDGDECHMAFHFPLMPRMYMALAMEDRFPITD
ILRQTPEIPANCQWAIFLRNHDELTLEMVTDRERDYLWNYYAEDRRARINLGIRRRLAPL
LQRDRRRIELLTSLLLSMPGTPTLYYGDELGMGDNIYLGDRDGVRTPMQWSPDRNGGFSK
ADPQRLVLPPVMDPLYGYQTVNVEAQGHDPHSLLNWNRRLLAVRNQQKAFGRGTLRMLSP
SNRRILAYVREYTDGQGSTEVILCVANVSRAAQAAELDLSAYVDKVPVEMLGGNAFPPIG
QLPFLLTLSPYGFYWFLLASHDSLPSWHNTPSEGMPELTTLVLRQRLEELLEAPSVDTLQ
DAILPQYLPKRRWFAGKEAPIDAVRIRYGVRFGTPTNPVLLSELEVVSDGLSTHYQLPLG
LLPEEQINSALPQQLALSRVRRGRQVGLITDAFVQEPFIRAVLRACQEGSQLPTEAGGLR
FECTEQLAALQLGEDSAVRYLSAEQSNSSVVIGERVVLKLIRRVNPGIHPELEMSAYLTA
AGFANISPLLAWVSRVDAQEQPHLLMIAQGYLSNQGDAWSWTQNTLERAIRDEMEPNPAS
AEAHTDALAELAGFATLLGQRLGEMHLLLGAPTDDSAFAPRPSEATDSARWGAQIAAELS
HALDLLGQHRAQLDADSQALVDDLQQQREGLAQHIEHLAQQAQGGLLMRVHGDLHLGQVL
VVQGDAYLIDFEGEPSRPLDERRAMHSPYKDVSGVLRSFDYAAAMILRSASAVDSSEAAG
QARQRIARQYLHQSRHAFVQAYGLATAAMPHAWQQADGERAALELFCLEKAAYEITYEAE
NRPSWLAVPLHGLHGLISTWGES
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcgttcccgcccggcagccttcatcgacgacccgctgtggtacaaggacgcg
gtgatctaccagttgcacatcaagtcgttcttcgatgccaacaatgacggcatcggtgat
tttgccggcctgatcagcaagctcgactacatcgccgcgctgggcgtcaacaccctctgg
ttactgccgttctatccctcgccacggcgcgatgatggctatgacatcgccgaatacaag
tccgtgcatccggactacggcagtctcgccgacgcccgacgcttcattgccgaggcgcat
cggcgtgggctgcgggtgatcacggagctggtcatcaatcacacctccgaccagcatccc
tggttccagcgtgcacggcgtgccaagcgcggcagcaaggcccgcgacttctatgtctgg
tccgatgacgaccagaagtacgacggcacgcggatcatcttcctcgacaccgagaagtcc
aactggacgtgggacccggtcgcaggccagtacttctggcaccgtttctattcccatcag
cccgatttgaacttcgacaacccgcaggtgatgaaggcggtcatcggggtgatgcgcttc
tggctcgacctgggcgtggacggtctgcggctggatgcgatcccctacctcatcgaacgc
gacggcacgaacaacgagaacctgcccgagacccatcgggtgctcaaggcgattcgcgcc
gagatcgacgccaactaccccgaccgcatgctgctggccgaggccaaccagtggccggaa
gacacgcgaccgtatttcggcgaaggcgatggcgatgaatgccacatggcgtttcacttc
cccttgatgccgcgcatgtacatggccctggccatggaagaccgtttccccatcaccgat
atcctgcgccagaccccggagattcccgccaactgccagtgggcgatcttcctgcgcaac
cacgatgagctgacgctggagatggtcaccgaccgcgagcgcgactacctctggaactac
tacgccgaagaccgtcgagcgcgcatcaacctcggcatccgccgtcgcttggcgccgctg
ctgcaacgcgaccgtcggcgcatcgaattgctcaccagcctgctgctgtcgatgcccggc
acgccgacgctgtactacggcgatgagctgggcatgggcgacaacatttatctgggtgac
cgcgatggcgtgcgcacgccgatgcagtggtcgcctgaccgcaacggcggtttttccaaa
gccgacccgcagcgcctggtgctgccgccggtgatggacccgctgtacggctaccagacc
gtcaacgtcgaagcgcaaggccacgacccgcattcgctgctcaactggaaccgccgcctg
ctggcggtgcgtaatcagcagaaggccttcggtcgcggcaccttgaggatgctcagcccg
agtaaccgccgcatcttggcgtacgtgcgcgagtacaccgatggccagggcagtactgaa
gtcatcctctgtgtcgccaacgtgtcgcgcgccgcccaggccgccgagctggacctgtcg
gcctatgtcgacaaggtgccggtggaaatgctcggcggcaacgcgttcccgccgatcgga
caactgccgtttctgctgaccctgtcgccttatggtttctattggttcctgctggcctcc
cacgacagcctgcccagctggcacaacacaccctccgaaggaatgcccgaattgaccacg
ctcgtgctgcgccagcgcctggaggaactgctcgaagcgccctccgtcgacaccctgcag
gacgccatcctgccccagtacctgcccaagcgccgctggttcgccggtaaggaagcgccg
atcgatgcggtgcgcatccgttatggcgtgcgcttcggcaccccgaccaacccggtgctg
ctcagcgagttggaggtggtcagcgacggcctgagcacccattaccaactgccactcggt
ctgctgcccgaagagcagatcaacagcgccttgccccagcaactggcgctgtcgcgagtg
cgtcgcgggcgtcaggtcggcttgatcaccgacgccttcgtccaggaacctttcatccgc
gccgtgctgcgggcctgccaggagggcagccaactgccgaccgaagcgggagggctgcgc
ttcgagtgcaccgagcaactggctgccctgcaattgggcgaagacagcgcggtgcgctac
ctcagtgccgagcagtccaacagttcggtggtgattggagagcgtgtcgtcctcaagttg
atccgccgggtcaatccgggcatccaccccgagttggaaatgagcgcctacctcacggca
gccgggttcgccaatatctcgccgttactggcctgggtcagccgcgtggatgcgcaggag
caaccgcacctgttgatgatcgcccaaggctacttgagcaatcagggcgatgcctggtcc
tggacccagaacaccctggagcgggcgatccgcgatgagatggagcccaaccctgccagc
gccgaggcgcataccgatgccctggccgagctggccggttttgccaccttgctgggccaa
cgcctgggtgagatgcacctgctgcttggcgcgccgaccgatgattcagccttcgcaccg
cgccccagcgaggccaccgacagtgcgcgctggggcgcgcagatcgccgccgaactgagc
cacgcgctggacctgctgggccagcaccgcgcgcagctggatgccgacagccaggcgctg
gtcgacgatctgcaacaacagcgcgaaggcttggcccagcacatcgaacacctggcgcag
caggcccaagggggtctgctgatgcgcgtgcacggcgacctgcatctggggcaggtgctg
gtggtgcagggcgatgcctatctgatcgatttcgaaggtgagccttcgcgtccgctggac
gaacggcgtgccatgcacagcccgtacaaagacgtcagcggtgtgctgcgctccttcgac
tatgctgctgcgatgatcctgcgcagcgcctcggcggtggactcgtccgaggctgccggt
caggcccgtcaacgcatcgcccggcaatacctgcaccagtcacgtcatgccttcgttcaa
gcctacggccttgccaccgccgccatgccccatgcctggcagcaggccgacggcgagcgt
gcggcactggagttgttctgcctggagaaagccgcgtacgagatcacctatgaagcggag
aatcgtccgagctggctggccgtgcctttgcatggcttgcatggactgatcagcacgtgg
ggcgagtcttga

DBGET integrated database retrieval system