KEGG   Pseudomonas parafulva: NJ69_09605Help
Entry
NJ69_09605        CDS       T03520                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ppv  Pseudomonas parafulva
Brite
KEGG Orthology (KO) [BR:ppv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NJ69_09605
Enzymes [BR:ppv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     NJ69_09605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like AlaDh_PNT_C FAD_oxidored DAO FAD_binding_3 NAD_binding_7 K_oxygenase FMO-like Thi4 Glutaredoxin NAD_binding_8 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AIZ33221
UniProt: A0A0A7JLG8
LinkDB All DBs
Position
complement(2271394..2272956)
Genome map
AA seq 520 aa AA seqDB search
MLDATLKSQLKTYLERVTQPIEIVASLDDGAKSREMHDLLVEIAGLSNLITLREDGSDAR
RPSFSLNRPGGDISLRFAGIPMGHEFTSLVLALLQVGGHPSKASAEVIEQIKALEGDFTF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQGEVESRKIMAVPSVYLNGEVF
GQGRMGLEEILGKIDTNAGSRQAEKINAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTLAIENFISVQETEGPKLATALEEHVKQYDVDIMNLQRGDALIPASEGGL
HEVRLASGASLKAKTVILATGARWREMNVPGEQEYRARGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAQVTLIEFDSQLRADAVLQRKLHSLPNVKVITSALTTEVLGNGE
KVTGLRYKDRTTELVHELALEGIFVQIGLLPNTDWLRGTVELSPRGEIIVDAKGQTSIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLAAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccacgcttaaatcgcaactgaaaacctacctggagcgggtcacccagccg
atcgagatcgttgcctccctcgacgacggggcgaaatcccgagaaatgcacgacctgctg
gttgaaatcgccggcctgtcgaacctcatcactctgcgcgaggacggcagcgatgctcgt
cgcccttcgttctcgctcaaccgcccagggggcgatatcagcctgcgcttcgccggcatc
ccgatgggtcacgaattcacctccctggtgctggcgctgctgcaagttggcggccacccc
tccaaggccagtgccgaagtgatcgaacagatcaaggcgctggagggcgatttcaccttt
gaaacctacttctcgttgtcgtgccagaactgcccggatgtggtccaggcgctgaacttg
atggcggtgctcaatcccaacatccgccacgtcgccatcgacggtgcgctgttccagggc
gaagtcgaatcgcgcaagatcatggcagtgcccagcgtctacctcaacggtgaggtgttc
ggccagggtcgtatgggcctggaggaaatccttggcaagatcgacaccaatgccggtagt
cgtcaggccgagaaaatcaacgctaaagatgctttcgatgtattggtggtcggtggtggt
cctgccggcgcggccgcagccatctacgccgcgcgtaaaggtattcgcaccggcgtggct
gcagagcgcttcggcggtcaggtcctcgacaccttggcgatcgagaacttcatttccgtt
caggaaaccgaagggccaaaactggccactgcactggaagaacacgtcaagcaatacgac
gtcgacatcatgaacctgcagcgtggcgacgcgctgattcctgccagtgagggtgggctg
cacgaggtgcgtctggccagcggtgcctcgctcaaggccaagacggtgattctggccact
ggcgcacgctggcgtgagatgaatgtgccgggcgagcaggagtaccgagcccgtggtgtg
gcttactgcccgcactgcgacggcccgttgttcaagggcaagcgtgtggcggtcattggt
ggtggcaactcgggtgtggaggcggccatcgacctggccggtatcgtcgcccaggtgacg
ctgatcgaattcgacagccaattgcgcgccgacgctgtgttgcagcgcaagttgcacagt
ctgccaaacgtcaaggtcatcaccagcgcgctgaccaccgaggtgctgggcaacggtgag
aaagtcacggggttgcgctacaaggatcgcaccaccgagctggtccacgagctagcgctg
gaaggcatctttgtacagatcggtctgctgccgaacaccgattggctcagagggaccgtc
gagctgtcgccgcgtggcgagatcattgtcgatgcgaaagggcagaccagcatccctggc
gtatttgcagccggtgatgtgaccaccgtgccgtacaagcagatcgtcattgccgtgggc
gagggcgccaaggcctcgctggctgctttcgatcacctgattcgtacgtccgcaccggcg
taa

DBGET integrated database retrieval system