KEGG   Pseudomonas parafulva: NJ69_10035Help
Entry
NJ69_10035        CDS       T03520                                 

Definition
(GenBank) 3-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
ppv  Pseudomonas parafulva
Pathway
ppv00061  Fatty acid biosynthesis
ppv01100  Metabolic pathways
ppv01212  Fatty acid metabolism
Module
ppv_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ppv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NJ69_10035
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ppv01004]
    NJ69_10035
Enzymes [BR:ppv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     NJ69_10035
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     NJ69_10035
Lipid biosynthesis proteins [BR:ppv01004]
 Fatty acid synthase
  Component type
   NJ69_10035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AIZ33296
UniProt: A0A0A7JLN4
LinkDB All DBs
Position
2372480..2372995
Genome map
AA seq 171 aa AA seqDB search
MTKQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMVDRITHISEEGGKYGKGELVAELDI
TPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFFLGWQGLPGRGRALGSGEVKFFGQVLPT
AKKVTYNIQIKRVLKGKLNMAIADGSVSVDGREIYTAEGLRVGVFTSTDNF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacaacacgcctttactcgggaagacctgctgcgctgcagtcgcggtgagctg
ttcggcccaggtaatgcgcaactgcccgccccgaacatgctgatggtcgatcgcatcact
catatcagcgaagaaggcggcaagtacggcaaaggtgaattggtcgctgagctggatatc
accccggacctgtggttcttcgcctgccatttcgaaggcgacccggtgatgccaggttgc
ctgggcctcgatgccatgtggcagctggtcggtttcttcctcggctggcaaggcctgccg
ggccgcggccgcgccctgggctcgggcgaagtgaagttctttggccaggtactgccgacg
gccaagaaagtcacctacaacattcagatcaagcgcgtcctcaaaggcaagctgaacatg
gccatcgccgatggctcggtcagcgtcgacggtcgcgagatctacaccgccgaaggcctg
cgggtcggcgtgttcacctccactgacaatttctaa

DBGET integrated database retrieval system