KEGG   Pseudomonas parafulva: NJ69_10135Help
Entry
NJ69_10135        CDS       T03520                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ppv  Pseudomonas parafulva
Pathway
ppv00020  Citrate cycle (TCA cycle)
ppv00190  Oxidative phosphorylation
ppv00650  Butanoate metabolism
ppv01100  Metabolic pathways
ppv01110  Biosynthesis of secondary metabolites
ppv01120  Microbial metabolism in diverse environments
ppv01130  Biosynthesis of antibiotics
ppv01200  Carbon metabolism
Module
ppv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ppv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ppv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NJ69_10135 (sdhB)
   00650 Butanoate metabolism
    NJ69_10135 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NJ69_10135 (sdhB)
Enzymes [BR:ppv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NJ69_10135 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     NJ69_10135 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: AIZ33316
UniProt: A0A0A7JLQ7
LinkDB All DBs
Position
complement(2395386..2396090)
Genome map
AA seq 234 aa AA seqDB search
MLKVEVYRYNPDTDSAPKMESFDVDTGGKDLMVLDVLALIKEKDEGFSYRRSCREGVCGS
DGMNMNGKNGLACITPLSGVVKGNKLVLRPLPGLPVIRDLVVDMSIFYKQYEKVKPFLQN
DTPAPAIERLQSPEQREKLDGLYECILCACCSTSCPSFWWNPDKFLGPAALLQAYRFLAD
SRDTKTQERLASLDDPFSVFRCRGIMNCVNVCPKGLNPTKAIGHVRNMLLQSGT
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcgaagtttatcgttacaacccggacaccgactcggcgcccaagatggag
tcgttcgacgtcgataccggcggcaaggacctgatggtgctggacgtgctggcgctgatc
aaggaaaaggacgagggcttctcgtaccgtcgctcctgccgtgaaggcgtgtgcggttcc
gatggcatgaacatgaacggcaagaacggcctggcctgcatcaccccgttgtcgggcgtg
gtcaagggcaacaagctggtgctgcgtccgctgccggggctgccggtcattcgtgacctg
gtcgtcgacatgagcatcttctacaagcagtacgagaaggtgaagccgttcctgcagaac
gatacgccggcaccggccatcgagcgtctgcagtcgccggaacagcgcgagaagctggac
ggtctgtacgagtgcatcctgtgcgcctgctgctcgacctcctgcccatcgttctggtgg
aacccggacaagttcctgggccccgccgcgctgctgcaggcctaccgtttcctggccgac
agccgtgacaccaagacccaggaacgcctggcgtcgctggatgacccgttcagcgtattc
cgctgccgcgggatcatgaactgcgtgaacgtctgcccgaagggtctcaacccgaccaag
gcgatcggccacgtacgtaacatgctgctgcaaagcggcacctga

DBGET integrated database retrieval system