KEGG   Pseudomonas parafulva: NJ69_11610Help
Entry
NJ69_11610        CDS       T03520                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ppv  Pseudomonas parafulva
Pathway
ppv00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ppv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NJ69_11610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppv02000]
    NJ69_11610
Enzymes [BR:ppv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NJ69_11610
Transporters [BR:ppv02000]
 Other Transporters
  Pores ion channels [TC:1]
   NJ69_11610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C GST_N_2 GST_C_3 GST_C_2 GST_C_6 Metal_resist GST_N_4
Motif
Other DBs
NCBI-ProteinID: AIZ33585
UniProt: A0A0A7JPY6
LinkDB All DBs
Position
complement(2724111..2724713)
Genome map
AA seq 200 aa AA seqDB search
MYKVYGDYQSGNCYKVKLMLSLLGRPCEWHPVDILKGETETPEFLARNPNGKVPVLELED
GTCLWESNAILNFLADGSEFLPTEPRLRTQVLQWQFFEQYSHEPYIAVARFIQFYLGLPQ
ERLEEYRKLHKGGYKALRVMERQLHMTPYLVGEQYSIADVALYAYTHVAHQGGFDLAEYP
AVRAWLERVASHPRHVPMVG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaggtgtatggggactatcagtcaggcaactgctacaaggtcaagttgatgctc
agtctgctgggacggccgtgtgagtggcacccggtggacattctcaagggcgaaaccgaa
acaccggaatttctcgcgcgcaatcccaacggcaaggttcccgtgctggagctcgaagac
ggtacctgcctgtgggaatccaacgccattctcaattttctcgccgatggcagcgagttt
ctgcccaccgagccgcgtttgcgtacccaggtgctgcaatggcagtttttcgagcagtac
agccatgagccctacatcgcggtagcgcgcttcatccagttctacctggggctgccgcag
gagcgcctggaggaataccgcaagctgcacaagggcggctacaaggcgctgagggtcatg
gaacggcagttgcacatgacgccgtacctggtgggcgagcagtactcgatcgccgatgtc
gcgctctatgcctatacccatgtggcccaccagggcggcttcgatctggccgagtatccc
gccgtgcgcgcctggctggagcgggtcgccagtcatccccggcacgtgccgatggtgggc
tga

DBGET integrated database retrieval system