KEGG   Pseudomonas putida W619: PputW619_0915Help
Entry
PputW619_0915     CDS       T00675                                 

Definition
(GenBank) methionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00270  Cysteine and methionine metabolism
ppw00450  Selenocompound metabolism
ppw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PputW619_0915
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PputW619_0915
Enzymes [BR:ppw01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     PputW619_0915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Met_gamma_lyase Aminotran_5 SelA DegT_DnrJ_EryC1 Beta_elim_lyase GDC-P
Motif
Other DBs
NCBI-ProteinID: ACA71420
UniProt: B1J171
LinkDB All DBs
Position
1010785..1011978
Genome map
AA seq 397 aa AA seqDB search
MRDSHNNTGFSTRAIHHGYDPLSHGGALVPPVYQTATYAFPTVEYGAACFAGEEAGHFYS
RISNPTLALLEQRMASLEGGEAGLALASGMGAITSTIWTLLRPGDELIVGRTLYGCTFAF
LHHGIGEFGVKIHHVDLNDAKALKAAINGKTRMIYFETPANPNMQLVDIAAVVEAVRGSD
VLVVVDNTYCTPYLQRPLELGADLVVHSATKYLSGHGDITAGLVVGRKALVDRIRLEGLK
DMTGAVLSPHDASLLMRGIKTLAVRMDRHCANALQVAQFLARQPQVELIHYPGLPSFAQY
ELAQRQMCLPGGMIAFELKGGIEAGRRFMNALQLFARAVSLGDAESLAQHPASMTHSSYT
PQERAHHGISEGLVRLSVGLEDVQDLLADIEQALGHL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgactcccataacaacaccggtttttccacacgtgccattcaccatggctacgat
ccgctttcccacggtggcgcgctggtgccgccggtgtaccagaccgctacctatgccttc
ccgaccgtcgaatacggtgctgcctgcttcgccggggaggaggcggggcacttctacagc
cgcatctccaaccccaccctggccttgcttgagcagcgcatggcctcgctggagggcggt
gaggcgggattggcgctggcgtcggggatgggcgccatcacttcgaccatctggaccctg
ctgcggcctggcgatgaactgatcgtcgggcgcaccttgtatggctgcaccttcgcgttc
ctgcaccatggcatcggcgagttcggggtcaagattcaccatgtcgaccttaacgatgcc
aaggccctgaaagcggcgatcaacggcaaaacgcggatgatctacttcgaaacgccggcc
aaccccaacatgcaactggtggatatagcggcggtcgtcgaggcagtgcgaggcagtgat
gtgcttgtggtggtcgacaacacctactgcacgccttatctgcagcggccgctggagctc
ggggcggacttggtggtgcattcggcgaccaagtacctcagtggccatggcgacattacc
gccggcctggtggtggggcgcaaggcgctggtcgaccgcattcgcctggaagggctgaaa
gacatgaccggggctgtactttcgccgcatgacgcttcgctattgatgcgcggtatcaag
acccttgcagtgcgcatggaccggcactgcgccaatgcactgcaggtggcgcagttcctg
gctcggcagccgcaggtggagctgattcactacccggggttgccgtcgtttgcccagtac
gaactggcacagcggcagatgtgtttgccgggcgggatgattgcctttgagcttaagggc
gggatcgaggccgggcgacgcttcatgaatgcgctgcaactgtttgcccgtgcggtaagc
ctgggggatgccgagtcgctggcgcagcacccggcgagcatgacgcactccagttacacg
ccgcaggagcgggcccatcatgggatatcggaagggttggtgcggttgtcggtggggctg
gaggatgtgcaagacctgctggcggacatcgagcaggcgctggggcatctgtag

DBGET integrated database retrieval system