KEGG   Pseudomonas putida W619: PputW619_0946Help
Entry
PputW619_0946     CDS       T00675                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00473  D-Alanine metabolism
ppw00550  Peptidoglycan biosynthesis
ppw01100  Metabolic pathways
ppw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppw00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    PputW619_0946
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PputW619_0946
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    PputW619_0946
Enzymes [BR:ppw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PputW619_0946
Peptidoglycan biosynthesis and degradation proteins [BR:ppw01011]
 Precursor biosynthesis
  Amino acid ligase
   PputW619_0946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATP-grasp ATPgrasp_Ter RimK ATPgrasp_YheCD ATP-grasp_5 GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: ACA71451
UniProt: B1J3L4
LinkDB All DBs
Position
1041424..1042380
Genome map
AA seq 318 aa AA seqDB search
MTSAYEKLHSTLDVKAFGRVAVLYGGKSAEREVSLKSGAAVIEALSSAGVDVVAIDVGDD
LLARLQSEKIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWQ
SLGIPTPRHAVLASEEDCVVAGTELGFPLIVKPAHEGSSIGMAKVNSERELVAAWQDAAK
YDSQVLVEQWIHGPEFTIAVLRGQVLPPIALGTPHVFYDYDAKYIANDTQYRIPCGLDSA
KEQELIDLTARACDAIGIEGWGRLDVMQDEQGRFWLLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILADSVATRG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgcctacgagaagttgcattcaaccctggacgtcaaagcgttcggccgtgtc
gctgtactttacggcggcaagagcgccgagcgtgaagtctcgctcaagtcgggcgctgcc
gtgatcgaggcgctgagcagcgccggtgtcgacgtggtcgccatagacgtgggcgatgac
ctgctggcccgcctgcaaagcgagaagatcgaccgtgccttcatcatcctgcacggccgc
ggcggtgaggacggcagcatgcaaggcctgctggagtgcctgggcattccctacaccggc
agtggcatcctcgcctcggctctggccatggacaagctgcggaccaagcaggtatggcaa
agcttgggcattccgacaccgcgtcacgccgtgctggccagcgaagaagattgtgttgta
gccggtacggaactgggcttcccgctgatcgtcaaacctgcccatgaaggctctagcatc
ggcatggccaaggtgaacagcgagcgggaactggttgctgcctggcaagacgccgccaaa
tacgattctcaggtgctggtcgagcaatggattcacggcccggagttcaccatcgctgtt
ctgcgtggccaggtgctgccgccgatcgccctgggtactccgcacgtgttctacgactac
gacgccaagtacatcgccaatgacacccagtaccgcatcccgtgcggcctggacagtgcc
aaggagcaggagcttatcgacctgaccgcgcgcgcctgcgatgccatcggcatcgaaggc
tggggccgtctggacgtgatgcaggatgagcagggccgattctggctgctcgaagtaaac
accgcaccgggcatgactgatcatagcctggtgcccatggcggcccgcgcggccggtctg
gacttccagcagctggtgctggcgatcctggccgacagcgtagcgacgcgaggttaa

DBGET integrated database retrieval system