KEGG   Pseudomonas putida W619: PputW619_1429Help
Entry
PputW619_1429     CDS       T00675                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ppw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PputW619_1429
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppw02000]
    PputW619_1429
Enzymes [BR:ppw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PputW619_1429
Transporters [BR:ppw02000]
 Other Transporters
  Pores ion channels [TC:1]
   PputW619_1429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 GST_C_6 GST_N_4
Motif
Other DBs
NCBI-ProteinID: ACA71934
UniProt: B1J5R2
LinkDB All DBs
Position
1569935..1570537
Genome map
AA seq 200 aa AA seqDB search
MYKVYGDYQSGNCYKVKLMLSLLDSPYEWHPVDILKGGTETPEFLAMNPNGKVPVLQLED
GTCLWESNAILNFLADGSEYLPSEPRLRTQVLQWQFFEQYSHEPYIAVARFIQFYLGLPD
ERVDEYRKLHKGGYKALRVMERQLQMTPYLVGEQYSIADVALYAYTHVAHQGGFDLAEYP
GVRAWLDRVAAHPRHVPMVG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaagtctatggcgactaccagtcgggcaactgttacaaggtcaagctgatgctg
agtctgctggacagcccttatgaatggcatccggtggatatcctcaagggggggaccgaa
acgcccgaatttctggcgatgaaccccaatggcaaggtgccggtgctgcagctcgaggac
ggcacctgcctgtgggagtccaacgccattctcaatttcctggccgatggcagcgagtac
ctgcccagcgagccgcgtttgcgtacccaggtgctgcagtggcagtttttcgaacagtac
agccatgagccgtacatcgccgtggcgcggttcatccagttttacctgggtttgcctgac
gagcgcgtggacgaataccgcaagctgcacaagggcggctacaaggcattgagggtgatg
gagcggcagttgcagatgacgccgtatctggtgggtgagcaatattcgattgccgatgtg
gcgttgtatgcctacacccatgtggcgcatcagggtgggttcgacctggccgagtacccg
ggggtgcgagcctggctggaccgggtggccgcgcatcctcggcatgtgccgatggtgggc
tga

DBGET integrated database retrieval system