KEGG   Pseudomonas putida W619: PputW619_2010
Entry
PputW619_2010     CDS       T00675                                 

Definition
(GenBank) 4-oxalocrotonate decarboxylase
  KO
K01617  2-oxo-3-hexenedioate decarboxylase [EC:4.1.1.77]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00362  Benzoate degradation
ppw00621  Dioxin degradation
ppw00622  Xylene degradation
ppw01100  Metabolic pathways
ppw01120  Microbial metabolism in diverse environments
ppw01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppw00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PputW619_2010
   00622 Xylene degradation
    PputW619_2010
   00621 Dioxin degradation
    PputW619_2010
Enzymes [BR:ppw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.77  2-oxo-3-hexenedioate decarboxylase
     PputW619_2010
SSDB
Motif
Pfam: FAA_hydrolase GSK-3_bind PEP-CTERM
Other DBs
NCBI-ProteinID: ACA72510
UniProt: B1J701
LinkDB
Position
complement(2242159..2242929)
AA seq 256 aa
MKIERIAKRLDDAALYAQATLQLGGEDTVTLEEAYAVQRLLIEKRLARGARQVGVKMGFT
SRAKMAQMGVSDLIWGRLTSDMWIEEGGSIDLSRYVHPRVEPEVCFLLGKRLEGHVTPLQ
ALAAVEAVAPALEVIDSRYCNFKFSLPAVVADNASSSGFVVGGWQRPDTDVGNLGLVMSF
DGRAVEMGSTAAILGAPVRALVAAARLAAQQGEALEPGSLVLAGAATAAVALRPGVAVRC
EFQDLGSVAFETLREE
NT seq 771 nt   +upstreamnt  +downstreamnt
atgaaaattgaacgtattgccaagcgcctcgacgatgccgccctgtacgcccaggccacg
ttgcaattaggcggcgaagataccgtgaccctggaagaggcttatgcggttcaacgcctg
ctgatcgagaagcgcctggcccgtggggcgcgccaggtgggcgtcaaaatgggctttacc
agccgcgccaagatggcgcagatgggcgtgtccgacctgatctgggggcggttgacctca
gatatgtggatcgaggaagggggcagcatcgacctgtctcgctacgtgcacccgcgcgtc
gaaccagaggtgtgtttcttgctgggcaagcgccttgaagggcacgttacgccgctgcag
gccctggccgctgtggaagcggtggcgccggcactggaggtgatcgactcgcgctattgc
aacttcaagttctcgctgcccgcggtggtggccgacaacgcctcatcgtccggcttcgtg
gtcggcggctggcagcgcccggacactgacgtgggcaacctggggcttgtgatgagtttc
gatggccgcgcggtggagatgggcagcacggcggcgatcctcggcgcgcctgtacgcgca
ctggtagcagcagcgcgcctggcggcgcaacaaggcgaggcgctagagcccggcagcctg
gtactggccggtgcggcgacggcggccgtggcgcttcgcccaggcgtagcggtgcgctgc
gaatttcaggacttgggaagcgtagcgtttgaaacgctgcgcgaggaataa

DBGET integrated database retrieval system