KEGG   Pseudomonas putida W619: PputW619_2572Help
Entry
PputW619_2572     CDS       T00675                                 

Definition
(GenBank) major facilitator superfamily MFS_1
  KO
K19577  MFS transporter, DHA1 family, inner membrane transport protein
Organism
ppw  Pseudomonas putida W619
Brite
Transporters [BR:ppw02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    PputW619_2572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_4 Sugar_tr Ndc1_Nup
Motif
Other DBs
NCBI-ProteinID: ACA73066
UniProt: B1J8C1
LinkDB All DBs
Position
complement(2854173..2855360)
Genome map
AA seq 395 aa AA seqDB search
MSVQEIPPVALSKGEIGKMEAAMALGSFAIGTGEFAIMGLMPDIAGNLQLSEPQVGHAIS
AYALGVVVGAPALAILGAKLLRKHMLLLLMALYAVGNLATAFAPSFAGLVAFRFISGLPH
GAYFGIAAVVASSMVPSNQRAGAVARVMMGLTLAMLLGNPVATLLGQYFGWRSAFLLVGL
IAVCTIALVWQYVPQRRDEARSDPRKELKAFTLPQVWMALAIASIGFAGMFCVFSYLAPT
MLEVTQVAPQWIPFGLAAFGIGGIIGNIAGGKLFDRLQFRAVGIVLVWSTAVLLFFTFAA
HALWTLLLGIGLVGTMIALAAPLQIRLMDIAHEAPSLAAASNHAAFNLANALGPWFGGMA
ISAGLGWTSTGYIGAAAALVGLGIYAVARRMKGGQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttcaggaaataccgccggtcgccctctccaaaggcgaaatcggcaagatggaa
gccgccatggccttgggcagttttgccattggcaccggcgaattcgcgatcatggggctg
atgccggacatcgccggcaacctgcaattgagcgaaccgcaggtaggccatgcgatcagc
gcttacgcgctgggcgtggtggtgggtgcgccggcgctcgccattcttggcgccaagctg
ctgcgcaagcacatgctgcttttgttgatggcgctgtatgccgtgggcaacctggccacc
gccttcgctccgtcgttcgcaggcctggtggccttccgcttcatcagcggcctgccccat
ggggcgtacttcggcatcgccgcggtggttgcctcgagcatggtgccgagcaaccagcgc
gccggtgccgtggcccgggtaatgatgggcctcacactggccatgttgctgggtaacccc
gtggcgacattgctggggcagtactttggctggcgctcggcgtttttgctggtaggcctg
atcgctgtgtgcaccatcgcgctggtctggcagtacgtgccgcagcgtcgcgatgaagca
cgcagtgacccacgcaaggagcttaaagccttcaccttaccgcaagtgtggatggcgctg
gccatcgcctcgatcggttttgccggcatgttctgtgtgttcagctacctcgcgccgacc
atgctagaggtgactcaggtcgccccccagtggatccccttcggcctggccgcattcggt
atcggcggcatcatcggcaacattgccggcggcaagctgttcgaccggctgcaattccgc
gccgtgggcatcgtactggtgtggtcgaccgccgtgctgttgttcttcaccttcgctgcc
catgcgctgtggacactgctgctgggcatcggcctggtcggcaccatgatcgcactggcc
gcccccttgcagatccgcctgatggacattgcccacgaagccccgagcctggcagcagcg
tccaaccatgcagccttcaacctggccaatgccttggggccttggtttggcggcatggcc
atcagtgccggactgggctggaccagcaccggctatatcggtgccgctgcggcgctggta
ggtctggggatctacgcggtggcacggcggatgaagggtggccagtag

DBGET integrated database retrieval system