KEGG   Pseudomonas putida W619: PputW619_3186Help
Entry
PputW619_3186     CDS       T00675                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ppw  Pseudomonas putida W619
Brite
KEGG Orthology (KO) [BR:ppw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PputW619_3186
Enzymes [BR:ppw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PputW619_3186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like AlaDh_PNT_C FAD_oxidored DAO FAD_binding_3 NAD_binding_7 Glutaredoxin Thi4 K_oxygenase FMO-like NAD_binding_8 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ACA73676
UniProt: B1JAB8
LinkDB All DBs
Position
complement(3524284..3525846)
Genome map
AA seq 520 aa AA seqDB search
MLDATLKSQLKTYLERVTQPIEIVASLDDGAKSRELHDLLVEIASLSNLITLSADGTDAR
RPSFSLNRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASAEVIEQIQALEGEFTF
ETYFSLSCQNCPDVVQALNLMAVLNPNVRHVAIDGALFQDEVESRKIMAVPSIYLNGEVF
GQGRMGLEEILGKIDTNAGTRQAEKINAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLATALEEHVKQYDVDIMNLQRGEALIPATDGGL
HEVRLAGGASLKAKTVILATGARWREMNVPGEQEYRARGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAQVTLIEFDSQLRADAVLQRKLHSLPNVKVITSALTTEVVGNGE
KVTGLRYKDRTTDEQHDLALEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDARGATSIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLAAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccacgcttaaatcgcaactgaaaacctacctggagcgggtcacccagccg
atcgagatcgttgcttccctcgacgacggcgcgaagtcccgcgaattgcacgacctgctg
gtggaaattgccagcctgtcgaacctcattaccttgagcgcggacggcaccgacgcccgt
cggccttcgttctcgctcaaccgcccgggcgctgacatcagcctgcgttttgccggcatc
cccatgggccacgaattcacctccctggtgctggcgctgctgcaagttggcggccacccc
tccaaggccagtgccgaagtgatcgagcagatccaggccttggaaggcgagttcaccttc
gagacctacttctcgctgtcgtgccagaactgcccggacgtggtccaggcgctgaacctg
atggcggtgctcaacccgaacgtacgccacgtggccatcgacggtgcgctgttccaggat
gaagtcgagtcgcgcaagatcatggcagtgcccagcatctacctgaacggcgaagtgttc
ggccaggggcgcatgggcctggaagaaatcctcggcaagatcgacaccaacgccggcacc
cgccaggccgaaaagatcaacgccaaggacgcctttgatgtgctggtggtcggcggtggc
cccgccggtgccgcggccgccatctacgcagcacgcaaaggcatccgtaccggtgtcgct
gccgagcgcttcggcggccaggtgctcgataccatggccatcgagaacttcatctcggtg
caggaaaccgaggggccgaaactggcaactgcactggaagagcacgtcaagcagtacgac
gtcgacatcatgaacctgcagcgcggtgaagcactgattcctgccaccgacggcggcctg
cacgaagtacgccttgccggcggtgcctcgctcaaagccaagactgtgatcctcgccacc
ggcgcccgctggcgcgaaatgaacgtgccgggtgagcaggaataccgcgcccgtggcgtg
gcttactgcccgcactgcgacggcccgttgttcaagggcaagcgtgtggcggtgatcggc
ggcggcaactccggcgtggaagcagccattgacctggcaggcatcgtcgcccaggtgacg
ttgatcgaattcgacagccagctgcgtgccgatgccgtgctgcagcgcaagttgcacagc
ctgccgaacgtcaaggtgatcaccagcgcgctgaccaccgaagtggtgggcaatggcgag
aaggtaaccggcctgcgctacaaggaccgtaccaccgacgagcagcatgacctggcgctg
gaaggtatctttgtgcagatcggcctgttgcctaacaccgactggctcaaggggacggtc
gagctgtcgccgcgcggtgagatcatcgtcgatgccagaggtgcgaccagcatcccgggc
gtgttcgcagccggcgatgtgaccaccgtgccgtacaaacagatcgtcattgcggtgggc
gagggtgccaaggcatcgctggcggccttcgatcacctgatccgtacctcggcgccggcg
taa

DBGET integrated database retrieval system