KEGG   Pseudomonas putida W619: PputW619_3497Help
Entry
PputW619_3497     CDS       T00675                                 

Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
ppw  Pseudomonas putida W619
Pathway
ppw00061  Fatty acid biosynthesis
ppw01100  Metabolic pathways
ppw01212  Fatty acid metabolism
Module
ppw_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ppw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PputW619_3497
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ppw01004]
    PputW619_3497
Enzymes [BR:ppw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PputW619_3497
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     PputW619_3497
Lipid biosynthesis proteins [BR:ppw01004]
 Fatty acid synthase
  Component type
   PputW619_3497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ACA73980
UniProt: B1JAU1
LinkDB All DBs
Position
3856650..3857165
Genome map
AA seq 171 aa AA seqDB search
MTKQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMVDRITHISEEGGKYGKGELVAELDI
TPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFFLGWQGLPGRGRALGSGEVKFFGQVLPT
AKKVTYNIHIKRVLKGKLNMAIADGSVSVDGREIYTAEALRVGVFTSTDNF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacaacacgcctttactcgggaagacctgctgcgctgcagtcgcggtgagctg
ttcggcccaggtaatgcgcaactgcccgcgccgaacatgctgatggtcgatcgcatcacc
catatcagcgaagaaggcggcaagtacggcaaaggtgaattggtcgccgagctggatatc
accccggacctgtggttcttcgcctgccatttcgaaggcgacccggtaatgcccggctgc
ctgggccttgacgccatgtggcagctggttggtttcttcctgggctggcagggccttcca
ggccgtggccgcgccctgggctcgggtgaagtgaaattctttggtcaggtattgcccacc
gccaagaaagtcacctacaacattcacatcaagcgcgtcctgaagggcaagctgaacatg
gccatcgccgatggctcggtcagcgttgacggccgcgagatctacactgccgaagccctg
cgggtcggcgtgttcacctccactgacaatttctaa

DBGET integrated database retrieval system