KEGG   Pseudomonas putida W619: PputW619_4751Help
Entry
PputW619_4751     CDS       T00675                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ppw  Pseudomonas putida W619
Brite
KEGG Orthology (KO) [BR:ppw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ppw03012]
    PputW619_4751
   03029 Mitochondrial biogenesis [BR:ppw03029]
    PputW619_4751
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppw04147]
    PputW619_4751
Translation factors [BR:ppw03012]
 Eukaryotic Type
  Elongation factors
   PputW619_4751
 Prokaryotic Type
   PputW619_4751
Mitochondrial biogenesis [BR:ppw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PputW619_4751
Exosome [BR:ppw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PputW619_4751
  Exosomal proteins of breast cancer cells
   PputW619_4751
  Exosomal proteins of colorectal cancer cells
   PputW619_4751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: ACA75227
UniProt: B1JDW6
LinkDB All DBs
Structure
PDB: 

Position
complement(5230534..5231727)
Genome map
AA seq 397 aa AA seqDB search
MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAIVEFDKIDSAPEEKARG
ITINTAHVEYNSTIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSARMALE
GKDDNEMGTTAVKKLVETLDSYIPEPVRAIDQPFLMPIEDVFSISGRGTVVTGRIERGIV
RVQDPLEIVGLRDTTTTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLVKPG
SVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
QMTVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaagaaaaatttgatcgttcccttccgcacgttaacgttggcaccatcggccac
gttgaccacggtaagaccactctgaccgcagctctgactcgcgtttgctccgaagttttc
ggctcggcaatcgttgagttcgacaagatcgactcggctccggaagaaaaagcgcgcggt
atcaccatcaacaccgctcacgttgagtacaactcgaccattcgtcactacgctcacgtt
gactgcccaggtcacgctgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggccgccgatggtccgatgccacaaacccgtgagcacatc
ctgctgtcccgtcaggttggcgttccgtacatcgtggtcttcctgaacaaggctgacctg
gtagacgacgctgagctgctggaactggtcgagatggaagttcgcgacctgctgtccacc
tacgacttcccaggcgacgacactccgatcatcatcggttccgctcgtatggccctggaa
ggcaaagacgacaacgaaatgggcactaccgctgtcaagaagctggtagaaactctggac
agctacattcctgagccagttcgtgccatcgaccagccgttcctgatgccgatcgaagac
gtattctcgatctcgggtcgtggtaccgttgttaccggtcgtatcgagcgtggtatcgtc
cgcgttcaggatccgctggaaatcgttggtctgcgtgacaccaccaccaccacctgcacc
ggtgttgagatgttccgcaagctgctggacgaaggtcgtgctggcgagaactgcggcgtt
ctgctgcgtggtaccaagcgtgacgacgttgagcgtggccaggttctggtcaagccaggt
tcggtcaagccgcacaccaagttcaccgcagaagtctacgttctgtcgaaggaagaaggc
ggccgtcacactccgttcttcaaaggctaccgtcctcagttctacttccgtaccactgac
gtgaccggtaactgcgaactgccggaaggcgttgaaatggtaatgccaggtgacaacatt
cagatgactgttaccctgatcaagaccatcgcaatggaagacggtctgcgcttcgctatc
cgtgaaggcggtcgtaccgtcggcgccggcgtcgtagccaaaatcatcgagtaa

DBGET integrated database retrieval system