KEGG   Pseudomonas putida DOT-T1E: T1E_1731Help
Entry
T1E_1731          CDS       T02181                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00473  D-Alanine metabolism
ppx01100  Metabolic pathways
ppx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    T1E_1731
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    T1E_1731
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppx01011]
    T1E_1731
Enzymes [BR:ppx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     T1E_1731
Peptidoglycan biosynthesis and degradation proteins [BR:ppx01011]
 Precursor biosynthesis
  Racemase
   T1E_1731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DUF5604
Motif
Other DBs
NCBI-ProteinID: AFO47579
UniProt: I7C7A8
LinkDB All DBs
Structure
PDB: 

Position
1896646..1897875
Genome map
AA seq 409 aa AA seqDB search
MPFRRTLLAASLALLITGQAPLYAAPPLSMDNGTNALTVQNSNAWVEVSASALQHNIRTL
QAELAGKSKLCAVLKADAYGHGIGLVMPSIIAQGVPCVAVASNEEARVVRASGFTGQLVR
VRLASLSELEDGLQYDMEELVGSAEFARQADAIAARHGKTLRIHMALNSSGMSRNGVEMA
TWSGRGEALQITDQKHLKLVALMTHFAVEDKDDVRKGLAAFNEQTDWLIKHAKLDRSKLT
LHAANSFATLEVPEARLDMVRTGGALFGDTVPARTEYKRAMQFKSHVAAVHSYPAGNTVG
YDRTFTLARESRLANITVGYSDGYRRVFTNKGHVLINGHRVPVVGKVSMNTLMVDVTDFP
DVKGGNEVVLFGKQAGGEITQAEMEEINGALLADLYTVWGSSNPKILVD
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccatttcgccgtacacttctggccgcatccctggccctgctgatcaccggccaagcc
ccactgtatgccgcccccccgctgtcgatggacaacggtaccaatgccctgaccgtgcaa
aacagcaatgcctgggtcgaagtcagcgccagcgccctgcagcacaacatccgcacgctg
caggccgagctggccggcaagtccaagctgtgcgccgtgctcaaggccgatgcctatggc
cacggtatcggcctggtaatgccatcgatcatcgcccagggcgtgccctgcgtggcggtg
gccagcaacgaggaggcccgcgtggtccgcgccagtggcttcaccgggcaactggtgcgg
gtacgcctggccagcctcagcgagctggaagatggcttgcagtacgacatggaagagctg
gtgggcagcgcggaatttgcccgccaggccgatgccatcgccgcgcgccatggcaagacc
ttgcgcattcacatggcgctcaactccagcggcatgagccgcaacggggtggagatggcc
acctggtccggccgtggcgaagcgctgcagatcaccgaccagaagcacctcaagctggtc
gcgctgatgacccacttcgccgtggaagacaaggacgatgtccgcaagggcctggcggcc
ttcaacgagcagactgactggttgatcaagcacgcgaagctcgaccgcagcaagctcacc
ctgcacgccgccaactcgttcgctacgctggaggtgccggaagcgcgcctggacatggta
cgaacagggggcgcgctgttcggtgacaccgtgccggcgcgcaccgagtacaagcgtgcg
atgcagttcaaatcgcacgtggctgcggtgcacagctatccggctggcaacaccgtgggc
tatgaccgcaccttcaccctggcccgtgaatcgcgcctggccaacattacggtcgggtac
tccgatggctaccgccgggtattcaccaacaagggccatgtgctgatcaacggccaccgt
gtgccggtggtgggcaaggtgtcgatgaacacgctgatggtcgatgtcaccgacttcccg
gacgtgaaggggggcaacgaagtggtgctgttcggcaagcaggccgggggcgaaatcacc
caggccgagatggaagaaatcaacggcgcgttgctggccgacctgtacaccgtgtggggc
agttccaacccgaagatcctcgtcgactga

DBGET integrated database retrieval system