KEGG   Pseudomonas putida DOT-T1E: T1E_2383Help
Entry
T1E_2383          CDS       T02181                                 

Gene name
fabB
Definition
(GenBank) 3-oxoacyl-(acyl carrier protein) synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00061  Fatty acid biosynthesis
ppx00780  Biotin metabolism
ppx01100  Metabolic pathways
ppx01212  Fatty acid metabolism
Module
ppx_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    T1E_2383 (fabB)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    T1E_2383 (fabB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ppx01004]
    T1E_2383 (fabB)
Enzymes [BR:ppx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     T1E_2383 (fabB)
Lipid biosynthesis proteins [BR:ppx01004]
 Fatty acid synthase
  Component type
   T1E_2383 (fabB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: AFO48231
UniProt: I7C538
LinkDB All DBs
Position
2612474..2613694
Genome map
AA seq 406 aa AA seqDB search
MRRVVITGLGIVSCLGNDKATVTENLRNSRPGIRFNPEYKEMGLRSQVSGSIDLNLEELI
DRKVYRFVGHAAAYAYLAMQDAIKDAGLTEEQVSNPRTGLVAGSGGASTLNQMEALDTLR
EKGVKRVGPYRVTRTMGSTVSACLATPFKIKGINYSISSACATSAHCIGTALEQIQWGKQ
DIVFAGGGEEEHWSQSFLFDAMGALSTKRNETPELASRAYDADRDGFVIAGGGGMVVVEE
LEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALSTVDTPIDYLNTHGTST
PVGDVAEIKGVRAVFGDKAPKISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSANID
ELDPEVADLPILRKTEEKAKIDTVMSNSFGFGGTNATLVLKRWEGK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcgtcgttatcactggtctgggcatcgtatcgtgcctgggcaatgacaaagct
accgtcaccgaaaacctgcgcaacagccgtccgggtatccgtttcaacccggaatacaag
gaaatggggctgcgtagccaggtttccggttccatcgacctcaacctcgaagaactgatc
gaccgcaaggtttaccgcttcgtcggccatgcggctgcctacgcctacctggccatgcag
gacgcgatcaaggacgccggcctgaccgaagagcaggtttccaacccgcgtaccggcctg
gtggccggttccggcggcgcctcgaccctgaaccagatggaagcgctggacaccctgcgt
gagaaaggcgtcaagcgcgtcggcccataccgcgttacccgcaccatgggcagcaccgtg
tcggcatgcctggccaccccgttcaagatcaagggcatcaactactcgatctcgtcggcc
tgcgccacttcggctcactgcatcggtaccgcactggagcagatccagtggggcaagcag
gacatcgtcttcgccggtggtggtgaagaagagcactggagccagtcgttcctgttcgat
gccatgggcgccctgtcgaccaagcgcaacgaaaccccggaactggcctcgcgcgcctac
gacgctgaccgtgatggtttcgtcatcgctggcggtggcggcatggtcgtggtcgaggaa
ctggaacacgccctggcccgcggcgccaagatctacgccgaaatcgttggctacggtgcg
acttccgacggctacgacatggttgcaccgagcggcgaaggcgccatccgctgcatgcag
caggcgctgtccactgtcgacaccccgatcgactacctgaacacccacggtacctcgacc
ccggtcggtgacgtggccgagatcaagggcgtgcgtgccgtgttcggcgacaaggcgccg
aagatcagctctaccaagagcctgtcgggtcactcgctgggcgctgccggcgtgcacgag
gcgatctactgcctgctgatgatggaaaacaacttcatcgccggctctgccaacatcgac
gagctggatccggaagtcgccgacttgccaatcctgcgtaaaaccgaagaaaaagccaag
atcgacacggtcatgagcaacagcttcggcttcggcggcaccaacgccaccctggtgctc
aagcgctgggaaggcaagtaa

DBGET integrated database retrieval system