KEGG   Pseudomonas putida DOT-T1E: T1E_2658Help
Entry
T1E_2658          CDS       T02181                                 

Definition
(GenBank) membrane-associated protein in eicosanoid and
Organism
ppx  Pseudomonas putida DOT-T1E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAPEG Myb_DNA-bind_2 DUF2101
Motif
Other DBs
NCBI-ProteinID: AFO48497
UniProt: I7BWH0
LinkDB All DBs
Position
2908271..2908696
Genome map
AA seq 141 aa AA seqDB search
MSSALQAYALCVVVLFLKMFLVSCYQGYHRLRFVAFTNPEDAAVFGRVAQAAERPQVIRA
AKVWANDLENIPLFFALGGLAVALEAATLPVLWLSVVFTVARILHTLAYLRGLQPWRTLF
YGIGVICLLGFCSLITARIGG
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgccttgcaggcctatgcgctgtgtgtggtggtgctgttcctcaagatgttc
ctggtttcctgctatcagggctatcaccgcttgcgcttcgtcgcgttcaccaacccggag
gacgctgccgtgttcgggcgcgtcgcccaggccgcagaacgcccgcaggtgatacgggct
gccaaggtatgggccaacgacctggagaacattcccctgttctttgccctcggcgggctg
gctgttgcgctggaagccgccacgctaccggtgttgtggctgagtgtggtgttcacggtt
gccaggatcctgcacacgctggcctacctgcgcggtttgcagccttggagaacgttgttc
tatggcatcggggtcatttgcctgctgggattctgctcactcatcaccgcgagaataggc
ggctga

DBGET integrated database retrieval system