KEGG   Pseudomonas putida DOT-T1E: T1E_3486Help
Entry
T1E_3486          CDS       T02181                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
ppx  Pseudomonas putida DOT-T1E
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    T1E_3486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AFO49322
UniProt: I7BYS0
LinkDB All DBs
Position
3833954..3834739
Genome map
AA seq 261 aa AA seqDB search
MDMLGSYWAEHGLLAILMLGAIAFVAGFVDSIAGGGGLFLVPGFLLVGMPPQVALGQEKL
VSTLGTLAAIRNFLANSKMVWQVALVGVPFSLLGAYLGAHLIVSISQETVGKIILALIPL
GILIFLTPKDRPVEERELSSRMLYTVVPLTCLVIGFYDGFFGPGTGSMFIIAFHYLLRMD
LVSSSANSKTFNFASNIGALVAFVSAGKVVYLLALPLVACNILGNHLGSSLALRKGNDVV
RKALVFSMLCLFISLGVKYLT
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggacatgttgggttcttactgggcggagcacgggttgctggcaatcctcatgcttggc
gcgatcgcttttgttgcgggcttcgttgacagcattgccgggggtggcggtttgttcctg
gtgccgggttttctgctggttggcatgccgccccaggtggcactgggccaggaaaaactg
gtcagtaccctcggcacgctggcggctatccgcaacttcctggccaacagcaagatggtc
tggcaggtagcgttggtgggggtgccgttttcgctattaggcgcctacctgggggcacac
ctgatcgtatcgatctcgcaggaaacggtgggcaagatcatcctggcactgatcccgctc
ggcattctcattttccttacccccaaggatcgtccggtcgaggagcgcgagctgtcttcg
cgaatgctgtacaccgtagtgccgttgacttgcctggtcatcggcttctatgacggcttc
ttcggccccggtaccggcagcatgttcatcatcgctttccattacctgctgcgcatggac
ctggtctccagttcagccaactccaaaaccttcaacttcgcttccaacatcggtgctttg
gtggcgttcgtcagcgcaggcaaggtcgtctacctgctggcattgccacttgtggcctgc
aacatcctcggtaaccacctgggcagttccctggccttgcgtaaaggcaacgacgtggtg
cgcaaggcgttggtgttctcgatgctctgtctgttcatcagcctgggcgtgaagtacctg
acctga

DBGET integrated database retrieval system