KEGG   Pseudomonas putida DOT-T1E: T1E_4026
Entry
T1E_4026          CDS       T02181                                 

Gene name
phoQ
Definition
(GenBank) integral membrane sensor signal transduction
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx01503  Cationic antimicrobial peptide (CAMP) resistance
ppx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    T1E_4026 (phoQ)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    T1E_4026 (phoQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ppx01001]
    T1E_4026 (phoQ)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ppx02022]
    T1E_4026 (phoQ)
   01504 Antimicrobial resistance genes [BR:ppx01504]
    T1E_4026 (phoQ)
Enzymes [BR:ppx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     T1E_4026 (phoQ)
Protein kinases [BR:ppx01001]
 Histidine kinases
  OmpR family
   T1E_4026 (phoQ)
Two-component system [BR:ppx02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   T1E_4026 (phoQ)
Antimicrobial resistance genes [BR:ppx01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    T1E_4026 (phoQ)
SSDB
Motif
Pfam: HATPase_c HATPase_c_2 HisKA HATPase_c_5 HAMP PhoQ_Sensor CorA OmpH HATPase_c_3 Methyltr_RsmB-F TatC
Other DBs
NCBI-ProteinID: AFO49856
UniProt: I7C9L1
LinkDB
Position
complement(4396198..4397544)
AA seq 448 aa
MIRSLRVRLMLAAAVLALLFMLALLPALQKAFSLALQESIEQRLASDVTTLISAARIEHG
QLQMPTLLPDERYNLPYTGLLGYIFDRDGKLVWQSRATADRHINYQPRYDGRGNEFDRIH
QSDGEEFFVYDVEIKLLGGQSAAYSIVALQPVSEYKATLNGLREKLYLGFGAALLALMVL
LWAGLTWGLRSLRRLSHELDEVESGARDGLSGEHPRELLRLTRSLNRLLRSEREQRTRYR
DSLDDLAHSLKTPLAVLQGVGESLQQRSGEREQARVLQSQIERMSQQIDYQLQRASLRKS
GLVRHSVLLRPLLDSLCSTLAKVYREKRVNVLLELPDAAQVPMEQGALLEMLGNLLENAY
RLSLGQVRVSLVKAPGYLTLCIEDDGPGVPADQRERILERGERLDSQHPGQGIGLAVVKD
IVDSYDAELSLGDSPLGGAAFRITFNLD
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgatccgctcgctgcgggtgcgcctgatgctggccgccgcagtgttggcgctgctgttc
atgctggcgctgctgccggccttgcagaaggccttcagcctggctctgcaggaatcgatc
gagcagcgtctggcctctgatgtgaccacgctgatttccgctgcgcgtatcgagcatggc
cagctgcagatgccgacactgctgccggacgagcgctacaacctgccctacacaggcctg
ctcggctatatctttgaccgcgacggcaagctggtctggcagtcgcgtgccaccgccgac
cggcacatcaactaccagccgcgctatgacgggcgcggcaacgagttcgaccgcattcac
cagtccgatggcgaagagttcttcgtgtacgacgtcgagatcaagctgttgggtgggcag
agtgccgcctacagcattgtcgctctgcagcccgtgagcgagtacaaggccaccctcaat
ggcctgcgcgaaaagctctacctggggttcggcgctgcattgctggcgctcatggtgttg
ttgtgggcaggcctgacctgggggctgcgctcgttgcgacgcctcagccacgaactggat
gaagtggaatcaggtgcacgtgacggtctgagcggtgagcacccacgcgagttgctgcgc
ctgacccgctcgctcaaccgtctgttgcgcagtgagcgtgagcagcgcacgcgctaccgt
gattcgctggacgacctggcccacagcctgaagacgccgctggcggtgttgcagggtgtg
ggtgaaagcttgcagcagcgcagcggcgagcgcgagcaggcgcgggtgctgcaaagccag
atcgagcgcatgagccagcagatcgactaccagctgcaacgcgccagcctgcgcaagagt
ggcctggtccgccacagcgtattgctgcggccgttgctcgacagcctgtgcagcaccttg
gccaaggtttaccgggaaaaacgtgtgaacgtgctgctggagttgccggacgcggcgcag
gtgccgatggagcagggcgcgttgctggaaatgctcggcaacctgctggagaacgcctac
cggctgagcctgggccaagtgcgggtgagcctggtgaaggcgccggggtatctgaccttg
tgcatcgaggacgacgggccgggcgtgcccgccgaccagcgtgaacgcattctggagcgt
ggggagcggctggacagccagcacccggggcagggcataggcttggccgtggtcaaggat
atcgtcgacagctatgacgccgaactgagccttggcgattcgccgctggggggcgctgcg
ttcaggatcaccttcaacctggattga

DBGET integrated database retrieval system