KEGG   Pseudomonas putida DOT-T1E: T1E_4358Help
Entry
T1E_4358          CDS       T02181                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00473  D-Alanine metabolism
ppx00550  Peptidoglycan biosynthesis
ppx01100  Metabolic pathways
ppx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    T1E_4358 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    T1E_4358 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    T1E_4358 (ddl)
Enzymes [BR:ppx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     T1E_4358 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ppx01011]
 Precursor biosynthesis
  Amino acid ligase
   T1E_4358 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATP-grasp ATPgrasp_Ter RimK ATPgrasp_YheCD TTL GARS_A ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AFO50187
UniProt: I7C1A7
LinkDB All DBs
Position
4739539..4740495
Genome map
AA seq 318 aa AA seqDB search
MTSAYDKLQSTLDVKAFGRVAVLYGGKSAEREVSLKSGAAVIDALSTAGVDVVGIDVGDD
LLARLQSEKIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWQ
SLGIPTPRHAVLASESDCLQASTELGFPLIVKPAHEGSSIGMAKVNSAQELVAAWQDAAK
YDSQVLVEQWIHGPEFTIAVLRGQVLPPIALGTPHVFYDYDAKYIANDTQYRIPCGLDSV
KEQELIDLTARACDAIGIEGWGRLDVMQDEQGQFWLLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAESVATRG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgcctacgacaagctgcagtcgaccctggacgtcaaggcgttcggccgcgtc
gccgtgctgtacggtggcaagagcgccgagcgtgaggtgtcgctgaaatctggcgccgca
gtgatcgatgcgctgagcactgccggcgtcgacgtggttggcatcgacgtcggtgacgac
ctgctcgcacgcctgcagagcgagaagattgaccgcgccttcatcatcctccacggccgt
ggcggtgaagacgggagcatgcaaggtttgctggagtgcctgggcatcccctacaccggc
agcggcatcctggcttctgcgctggcgatggacaagctgcgcaccaagcaggtgtggcag
agcctgggcattcccacgccacgccacgcggtgctggcgagcgaaagcgattgtttgcag
gccagtacggaactgggcttcccgcttatcgtcaaacccgcccatgaaggctctagcatc
ggcatggccaaggtgaacagcgcccaggaactggtcgccgcctggcaggacgccgccaaa
tacgattcccaggtactggtggagcagtggatccacggtccggagttcaccatcgcggta
ctgcgcggccaggtgctgccgccgatcgccctgggtacgccgcacgtgttctacgactac
gacgccaagtacatcgccaacgatacccagtaccgcatcccgtgcgggctggatagcgtc
aaggaacaggaactgatcgacctgaccgcgcgcgcctgcgatgccattggcatcgaaggc
tgggggcggttggacgtgatgcaggacgagcagggccagttctggctgctcgaagtcaac
accgcaccaggcatgacagatcatagcctggtgcccatggcggcccgcgcggctggcctg
gacttccagcaactggtgctggcaatcctggccgaaagcgtggcgacgcgaggttaa

DBGET integrated database retrieval system