KEGG   Pseudomonas putida DOT-T1E: T1E_5615Help
Entry
T1E_5615          CDS       T02181                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ppx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    T1E_5615
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppx03400]
    T1E_5615
Enzymes [BR:ppx01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     T1E_5615
DNA repair and recombination proteins [BR:ppx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     T1E_5615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AFO51436
UniProt: I7CDZ3
LinkDB All DBs
Position
6115842..6118343
Genome map
AA seq 833 aa AA seqDB search
MAKPLQEYARKRDFNATPEPSGKRKRGKRAHALQFCIQKHDASHLHYDFRLELDGTLKSW
AIPKGPSLDPKVRRLAVHVEDHPLDYADFEGHIPEGHYGAGDVIVWDRGIWEPEGDAHEA
YVKGKLRFRLQGEKLAGVWNLFRTHLAGKKEQWMLVKSHDAQARSETEYSIVEALPDSVL
SERTLVPRKSAAKKATAPRSSRKRADKVQAAPLPAQLQPQLATLVDSPPSGDWRYEVKFD
GYRILARIEGQDIRLFTRNGHDWSSKMPRQVAALRALGIDSAWLDGEMVVADENGMADFQ
ALQNAFDTEHDERITYYLFDLPFLRGQDLRQLPLQHRRDTLRQLLEHNHSDFIKYSADFD
EPVESLLDSACRLKLEGLIGKRADSVYSGRRSPDWIKLKCKQRQEFVIVGYTDPKGSRSG
FGALLLALHDNERGELRYAGKVGTGFNTTTLASIHTRLKPLEIACPALPSPPAGAEARGV
HWLRPQLLAEVAFAQMTRDGIVRHSVFHGLRDDKAATAIDLERAMPAKTVSNRNKQAKAS
ENLGELRLTHPDRVIDPTTGVTKREVAEYYAGISQWILPQLKHRPVALVRAPDGLGGELF
FQKNAGQLHIPNVLSYEKAEAGQAAMVINRPDTLLGAVQMNTLELHTWNATDKDFDKPDR
FVLDLDPDPALPWKAMVEATQLALTLLDELGLKVFLKTSGGKGIHVVVPLTRRAGWDEVK
DFSHAIVNYLAKLFPERLSAVSGPKNRVGRIFIDYLRNGKGATTACAYSLRARDGLPVSV
PIWREELAQIKAANQWNITNLHERLAEVDDPWADMGKVRQSITARMRKQLGLE
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcccctgcaggaatatgcgcgcaagcgcgacttcaacgccacgcccgagccc
agcggcaaacgcaaacgtggcaagcgggcccatgcgctgcagttctgcatccagaagcac
gacgccagtcacctgcactacgacttccgcctcgagctcgacgggaccctgaaaagctgg
gcgatccccaaaggcccatcgctggaccctaaggtgcgccgcctggcagtgcatgtggag
gaccatccgttggactacgccgatttcgagggccatatccctgaaggccactatggtgca
ggcgatgtgatcgtctgggaccgcggtatctgggagcctgaaggcgatgcccatgaagcc
tacgtcaaaggcaagctgcgtttccgcctgcaaggcgagaagctagccggcgtgtggaac
ctgtttcgcacccacctggccggcaagaaagaacaatggatgctggtcaagtcgcacgac
gcccaggcgcgcagcgaaaccgagtacagcattgtcgaggccctgcccgacagcgtgctc
agcgagcgcacgctggtgccacgcaaatccgctgcaaaaaaagccactgccccgcgcagc
agccgtaaacgcgccgacaaagttcaggctgcccccttgccagcacagctacagccacag
ctggcaacgttggtggattctccacccagcggcgactggcgctacgaagtcaagttcgat
ggctaccgtatcctggcccgaatagagggccaggacatccgcctgttcacccgcaacggc
catgactggagcagcaagatgccccggcaggtggctgccctgcgcgcgctcggtatcgac
tcggcctggctcgatggcgaaatggtggtggctgatgagaatggcatggctgacttccag
gcgttgcagaacgccttcgataccgagcacgacgaacgcatcacctattacctgttcgac
ctgccatttctgcgcggtcaggacctgcgacagctaccgctgcagcaccgccgcgatacg
ttgcgccaactgcttgagcacaaccattccgacttcatcaagtattccgccgacttcgac
gaacctgtcgaatcgctactcgacagtgcctgccggctgaagctggaaggcctgatcggc
aagcgtgctgacagtgtttacagcggccgccgtagcccagactggatcaagctcaagtgc
aagcaacgccaggaattcgtgatcgtcggctacaccgaccccaaaggcagtcgcagcggc
ttcggtgccctgctgctggccctgcacgacaatgagcgtggcgagctgcgctatgccggc
aaggttggtaccggcttcaacaccacgacactggccagcatccacacgcggctcaagccc
ttggaaatcgcctgccctgccctgccctcgccacctgccggagccgaagcgcgtggtgtg
cactggctgcggccgcagttgttggctgaagtcgcctttgcccagatgacccgtgacggc
atcgtgcggcattcggtgttccacggcctgcgcgatgacaaggcggccaccgccattgac
ctggagcgcgccatgcccgcaaaaactgtatccaaccgcaacaagcaggccaaggcgtct
gagaacctgggtgaactgcggctgacccaccccgaccgggtcatcgaccccaccacgggt
gtgaccaagcgcgaagtcgccgagtattacgctggcatcagccagtggatcctgccacag
ctcaagcaccgcccggtggcattggtgcgcgccccggacggcttgggtggcgagctgttc
ttccagaaaaacgcgggccagctgcacatacccaacgtgctcagttatgaaaaggccgag
gcaggccaggcggcgatggtcatcaatcgcccggacacgctgctgggcgcggtgcagatg
aatacgctggaactgcacacctggaacgccacggacaaggatttcgacaagccggaccgt
tttgtcctcgacctggaccctgatcctgcgctgccctggaaggcgatggtggaggcgacc
caactggccctcaccctgctggatgaactgggcctgaaggtgttcctgaaaaccagtggt
ggcaagggtattcacgtggttgtgcccttgacccgacgtgccggctgggacgaagtcaag
gacttcagccacgccatcgtcaattacctggccaagctgtttccggagcgcctgagcgcg
gtgtcggggccgaaaaatcgcgtgggacgcatcttcatcgactacctgcgcaatggcaag
ggcgctaccacggcgtgcgcctattcactgcgagcccgtgacgggctgccagtatcggta
cctatctggcgtgaggaactggcgcaaatcaaggccgccaaccaatggaacatcaccaac
ctgcacgagcgtctggcggaggtcgacgacccttgggccgacatgggcaaggtacgccag
tcgatcaccgcgcgcatgcgcaagcaactagggctcgaatga

DBGET integrated database retrieval system